P01714 LV319_HUMAN
Gene name: IGLV3-19
Protein name: Immunoglobulin lambda variable 3-19
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q6TFL3 | CCDC171 | 0.92333 | |
2 | Q8N4H0 | SPATA6L | 0.92076 | reproduction GO:0000003 |
3 | Q8N6C5 | IGSF1 | 0.85104 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 signal transduction GO:0007165 |
4 | C9J798 | RASA4B | 0.84929 | signal transduction GO:0007165 |
5 | Q9BS31 | ZNF649 | 0.84844 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
6 | O43374 | RASA4 | 0.8427 | cellular protein modification process GO:0006464 signal transduction GO:0007165 |
7 | Q6NT04 | TIGD7 | 0.82828 | |
8 | Q8TDU6 | GPBAR1 | 0.81403 | cell junction organization GO:0034330 cell population proliferation GO:0008283 cellular component assembly GO:0022607 ... |
9 | Q8N9F8 | ZNF454 | 0.80385 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
10 | Q7L1W4 | LRRC8D | 0.79751 | response to stress GO:0006950 transmembrane transport GO:0055085 transport GO:0006810 |
20 40 60 80 100 AA: MAWTPLWLTLLTLCIGSVVSSELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPDRFSGSSSGNTASLTITGAQAED STMI: SSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: D................................................................................................... DO_IUPRED2A: ............................................................................DDDDDD........DDD....... DO_SPOTD: ...............DDDDDDDDDDDDDDD...................................................................... CONSENSUS: ................................................................................ CONSENSUS_MOBI: ......................................................DDDDDDDDDDDDDDDDDDDDD..... RICH_MOBI_[S]: SgSSSgntaS
AA: EADYYCNSRDSS STMI: DO_DISOPRED3: ............ DO_IUPRED2A: ............ DO_SPOTD: .........DDD CONSENSUS: ............ CONSENSUS_MOBI: ............