P01714 LV319_HUMAN

Gene name: IGLV3-19
Protein name: Immunoglobulin lambda variable 3-19

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q6TFL3 CCDC171 0.92333
2 Q8N4H0 SPATA6L 0.92076 reproduction GO:0000003
3 Q8N6C5 IGSF1 0.85104 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
signal transduction GO:0007165
4 C9J798 RASA4B 0.84929 signal transduction GO:0007165
5 Q9BS31 ZNF649 0.84844 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
6 O43374 RASA4 0.8427 cellular protein modification process GO:0006464
signal transduction GO:0007165
7 Q6NT04 TIGD7 0.82828
8 Q8TDU6 GPBAR1 0.81403 cell junction organization GO:0034330
cell population proliferation GO:0008283
cellular component assembly GO:0022607
...
9 Q8N9F8 ZNF454 0.80385 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
10 Q7L1W4 LRRC8D 0.79751 response to stress GO:0006950
transmembrane transport GO:0055085
transport GO:0006810

                                           20                  40                  60                  80                 100
AA:                      MAWTPLWLTLLTLCIGSVVSSELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGIPDRFSGSSSGNTASLTITGAQAED
STMI:                    SSSSSSSSSSSSSSSSSSSS                                                                                
DO_DISOPRED3:            D...................................................................................................
DO_IUPRED2A:             ............................................................................DDDDDD........DDD.......
DO_SPOTD:                ...............DDDDDDDDDDDDDDD......................................................................
CONSENSUS:                                   ................................................................................
CONSENSUS_MOBI:                              ......................................................DDDDDDDDDDDDDDDDDDDDD.....
RICH_MOBI_[S]:                                                                                           SgSSSgntaS          

                                 
AA:                      EADYYCNSRDSS
STMI:                                
DO_DISOPRED3:            ............
DO_IUPRED2A:             ............
DO_SPOTD:                .........DDD
CONSENSUS:               ............
CONSENSUS_MOBI:          ............