P02818 OSTCN_HUMAN
Gene name: BGLAP
Protein name: Osteocalcin
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell adhesion GO:0007155
- cell differentiation GO:0030154
- homeostatic process GO:0042592
- immune system process GO:0002376
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q99439 | CNN2 | 0.55576 | cytoskeleton organization GO:0007010 immune system process GO:0002376 signal transduction GO:0007165 ... |
| 2 | Q06828 | FMOD | 0.5194 | |
| 3 | Q8NDY8 | TMEM52 | 0.49572 | |
| 4 | Q9UQ52 | CNTN6 | 0.49074 | |
| 5 | Q9UBV7 | B4GALT7 | 0.49074 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cell population proliferation GO:0008283 ... |
| 6 | Q969P0 | IGSF8 | 0.49074 | |
| 7 | O15178 | TBXT | 0.48934 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 8 | Q8WV15 | TMEM255B | 0.48702 | |
| 9 | Q6UXY8 | TMC5 | 0.48299 | |
| 10 | P56748 | CLDN8 | 0.46515 | cell adhesion GO:0007155 cell junction organization GO:0034330 cellular component assembly GO:0022607 |
20 40 60 80 AA: MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV STMI: SSSSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDD.D..DD.............DDDDDDDD...................................................................... DO_IUPRED2A: ...............................DDD.....................................D............................ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................. CONSENSUS: DDDDDDDDDDD.................................................................. CONSENSUS_MOBI: ............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD. RICH_MOBI_[P]: PvPyPdPlePrrevcelnP RICH_MOBI_[Y]: YlYqwlgapvpY RICH_MOBI_[CD]: CelnpDCDelaD RICH_MOBI_[CE]: EprrEvCElnpdCdE RICH_MOBI_[LY]: LYqwLgapvpYpdpL RICH_fLPS_MOBI_[Y]: YlYqwlgapvpYpdpleprr