P05019 IGF1_HUMAN

Gene name: IGF1
Protein name: Insulin-like growth factor I

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- carbohydrate metabolic process GO:0005975
- catabolic process GO:0009056
- cell adhesion GO:0007155
- cell cycle GO:0007049
- cell death GO:0008219
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- developmental maturation GO:0021700
- embryo development GO:0009790
- generation of precursor metabolites and energy GO:0006091
- growth GO:0040007
- immune system process GO:0002376
- mitotic cell cycle GO:0000278
- mitotic nuclear division GO:0140014
- protein transport GO:0015031
- reproduction GO:0000003
- response to stress GO:0006950
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
- transmembrane transport GO:0055085
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P0DPH9 CXorf51B 0.77674
2 Q9Y283 INVS 0.71698 anatomical structure development GO:0048856
cell-cell signaling GO:0007267
signal transduction GO:0007165
3 P29536 LMOD1 0.69784 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
4 Q01831 XPC 0.6922 biosynthetic process GO:0009058
cell cycle GO:0007049
cellular component assembly GO:0022607
...
5 F5H4B4 FAM227A 0.69095
6 O96028 NSD2 0.66281 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
...
7 Q5VSY0 GKAP1 0.6625 signal transduction GO:0007165
8 P46013 MKI67 0.658 cell cycle GO:0007049
cell population proliferation GO:0008283
chromosome organization GO:0051276
...
9 Q8NFC6 BOD1L1 0.64785 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
10 Q9UIG0 BAZ1B 0.64309 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...

                                           20                  40                  60                  80                 100
AA:                      MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSC
STMI:                    SSSSSSSSSSSSSSSSSSSSS                                                                               
DO_DISOPRED3:            DDDDDDD..................DDDDDDDDDDD................................................................
DO_IUPRED2A:             ..................................................................................DD................
DO_SPOTD:                DDDDDDDDDDDDDDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................DD...DDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                                    ....DDDDDDDDDDD..............................................DD................
CONSENSUS_MOBI:                               ...............................................................................

                                          120                 140                 160                 180     
AA:                      DLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK
STMI:                                                                                                                   
DO_DISOPRED3:            ................DDDDDDDDD.........................DD...........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ..................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDD...DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ..................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[K]:                                              KtqKyqppstnKntKsqrrKgwpKthpggeqK                                 
RICH_[R]:                                                                                       RgkkkeqRReigsRnaecR     
RICH_[T]:                                          TdmpkTqkyqppsTnknT                                                   
RICH_[EG]:                                                                        GGEqkEGtEaslqirGkkkE                  
RICH_[EK]:                                                                          EqKEgtEaslqirgKKKE                  
RICH_[GK]:                                                           KsqrrKGwpKthpGGeqKeG                               
RICH_[KN]:                                                       NKNtKsqrrK                                             
RICH_[KR]:                                                                                        KKKeqRReigsRnaecRgKKgK
RICH_[KT]:                                         TdmpKTqKyqppsTnKnTK                                                  
RICH_MOBI_[K]:                                         KtqKyqppstnKntKsqrrKgwpKthpggeqK                                 
RICH_MOBI_[R]:                                                                                  RgkkkeqRReigsRnaecR     
RICH_MOBI_[T]:                                     TdmpkTqkyqppsTnknT                                                   
RICH_MOBI_[EG]:                                                                   GGEqkEGtEaslqirGkkkE                  
RICH_MOBI_[EI]:                                                                        EgtEaslqIrgkkkEqrrEI             
RICH_MOBI_[EK]:                                                                     EqKEgtEaslqirgKKKE                  
RICH_MOBI_[GK]:                                                      KsqrrKGwpKthpGGeqKeG                               
RICH_MOBI_[IR]:                                                                                IRgkkkeqRReIgsRnaecR     
RICH_MOBI_[KN]:                                                  NKNtKsqrrK                                             
RICH_MOBI_[KR]:                                                                                   KKKeqRReigsRnaecRgKKgK
RICH_MOBI_[KT]:                                    TdmpKTqKyqppsTnKnTK