P05387 RLA2_HUMAN

Gene name: RPLP2
Protein name: 60S acidic ribosomal protein P2

List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cellular nitrogen compound metabolic process GO:0034641
- nucleobase-containing compound catabolic process GO:0034655
- protein targeting GO:0006605
- protein transport GO:0015031
- translation GO:0006412
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P05386 RPLP1 0.80985 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
2 Q9NWT6 HIF1AN 0.61776 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
3 P58872 RHBDL3 0.61242
4 Q9GIP4 SLC7A5P2 0.60256
5 P48050 KCNJ4 0.59834 circulatory system process GO:0003013
transmembrane transport GO:0055085
transport GO:0006810
6 A2RRP1 NBAS 0.59531 catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
nucleobase-containing compound catabolic process GO:0034655
...
7 Q9BUF5 TUBB6 0.59024 cell cycle GO:0007049
cytoskeleton organization GO:0007010
mitotic cell cycle GO:0000278
8 Q9NYC9 DNAH9 0.58169
9 O43633 CHMP2A 0.57555 biological process involved in symbiotic interaction GO:0044403
catabolic process GO:0009056
cell cycle GO:0007049
...
10 Q9P2D3 HEATR5B 0.56755 transport GO:0006810
vesicle-mediated transport GO:0016192

                                           20                  40                  60                  80                 100
AA:                      MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKE
STMI:                                                                                                                        
DO_DISOPRED3:            ...................................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ..........................................D................................D.D...DDDDDDDDDDDDDDDDDDD
DO_SPOTD:                ...........................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ...................................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ....................................................................................................
RICH_[AE]:                                                                                               ApAAgsApAAAEEkkdEkkE
RICH_[AG]:                                                                                  GGAvAvsAApGsAApAAGsA             
RICH_[AK]:                                                                                              AApAAgsApAAAeeKKdeKK 
RICH_[A]:                                                                                     AvAvsAApgsAApAAgsApAAA         
RICH_[D]:                                                                                                               Dekke
RICH_[E]:                                                                                                           EEkkdEkkE
RICH_[DE]:                                                                                                          EEkkDEkkE
RICH_[DK]:                                                                                                            KKDeKKe
RICH_[EK]:                                                                                                          EEKKdEKKE
RICH_fLPS_[A]:                                                                                AvAvsAApgsAApAAgsApAAA         
RICH_fLPS_[E]:                                                                                               gsapaaaEEkkdEkkE

                              
AA:                      ESEESDDDMGFGLFD
STMI:                                   
DO_DISOPRED3:            DDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDD.
DO_SPOTD:                DDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ...............
RICH_[AE]:               EsEE           
RICH_[D]:                eseesDDDmgfglfD
RICH_[E]:                EsEE           
RICH_[DE]:               EsEEsDDDmgfglfD
RICH_[DF]:                    DDDmgFglFD
RICH_[DK]:               eseesDDD       
RICH_[EK]:               EsEE           
RICH_fLPS_[E]:           EsEE