P05408 7B2_HUMAN

Gene name: SCG5
Protein name: Neuroendocrine protein 7B2

List of terms from Generic GO subset, which this protein is a part of:
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- protein maturation GO:0051604
- protein transport GO:0015031
- signal transduction GO:0007165
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q86YI8 PHF13 0.56072 cell cycle GO:0007049
cell division GO:0051301
chromosome organization GO:0051276
...
2 Q1RN00 n/a 0.50119
3 Q14562 DHX8 0.47719 cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
4 Q9Y6R1 SLC4A4 0.45793 carbohydrate metabolic process GO:0005975
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...
5 Q9P1Y6 PHRF1 0.4529 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
6 Q9H6H4 REEP4 0.45042 cell cycle GO:0007049
cell division GO:0051301
membrane organization GO:0061024
...
7 Q9BRD0 BUD13 0.4484 cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
8 Q9BYW2 SETD2 0.4392 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biological process involved in symbiotic interaction GO:0044403
...
9 Q9HCK8 CHD8 0.43521 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell death GO:0008219
...
10 O60716 CTNND1 0.43349 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
cell adhesion GO:0007155
...

                                           20                  40                  60                  80                 100
AA:                      MVSRMVSTMLSGLLFWLASGWTPAFAYSPRTPDRVSEADIQRLLHGVMEQLGIARPRVEYPAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTG
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSSSS                                                                          
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................................
DO_IUPRED2A:             ............................D..D...D.DDD........................DDD.DDDDDD.DD.DDDDD............D....
DO_SPOTD:                DDDDDDDDDDDDDDD....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                                         DDDDDDDDDDDDDD........................DDDDDDDDDDDDDDDDDDD............D....
CONSENSUS_MOBI:                                    DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_MOBI_[G]:                                                                                GpqsieGGaheGlqhlGpfG           
RICH_MOBI_[I]:                                                                                                     IpnIvaeltg
RICH_MOBI_[N]:                                                                                                    NipNivaeltg
RICH_MOBI_[FI]:                                                                                                 FgnIpnIvaeltg
RICH_MOBI_[GH]:                                                                                     GGaHeGlqHlGpfG           
RICH_MOBI_[GI]:                                                                                   IeGGaheGlqhlGpfGnIpnI      
RICH_MOBI_[IL]:                                                 IqrLLhgvmeqLgI                                               
RICH_MOBI_[IN]:                                                                                                   NIpNIvaeltg

                                          120                 140                 160                 180                 200
AA:                      DNIPKDFSEDQGYPDPPNPCPVGKTADDGCLENTPDTAEFSREFQLHQHLFDPEHDYPGLGKWNKKLLYEKMKGGERRKRRSVNPYLQGQRLDNVVAKKS
STMI:                                                                                                                        
DO_DISOPRED3:            ....................................................................................................
DO_IUPRED2A:             DD..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DD.DD..DDD.............D..DDD.DDDDDDDDDDDDDDDDDD.DDDD
DO_SPOTD:                DDDDDDDDDDDDD....DD...DDDDDDDD........................D...DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDD....DDDDDDDDDDDDD........................D...............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[D]:                                                                                                            Dnvvakks
RICH_[R]:                                                                                            RRkRRsvnpylqgqR         
RICH_[V]:                                                                                                  VnpylqgqrldnVVakks
RICH_[KR]:                                                                                     KmKggeRRKR                    
RICH_MOBI_[C]:                              CpvgktaddgC                                                                      
RICH_MOBI_[D]:           DnipkDfseDqgypD                                                                             Dnvvakks
RICH_MOBI_[F]:                                                  FsreFqlhqhlF                                                 
RICH_MOBI_[RY]:                                                                              YekmkggeRRkRRsvnpY              
RICH_MOBI_[I]:           dnI                                                                                                 
RICH_MOBI_[K]:                                                                        KwnKKllyeKmKggerrK                     
RICH_MOBI_[L]:                                                            LfdpehdypgLgkwnkkLL                                
RICH_MOBI_[N]:           dN                                                                                                  
RICH_MOBI_[P]:              PkdfsedqgyPdPPnPcP                                                                               
RICH_MOBI_[R]:                                                                                       RRkRRsvnpylqgqR         
RICH_MOBI_[V]:                                                                                             VnpylqgqrldnVVakks
RICH_MOBI_[Y]:                                                                   YpglgkwnkkllY                               
RICH_MOBI_[DP]:                       PDPPnPcPvgktaDD                                                                        
RICH_MOBI_[FH]:                                                 FsreFqlHqHlFdpeH                                             
RICH_MOBI_[FI]:          dnIpkdF                                                                                             
RICH_MOBI_[GK]:                                                                    GlGKwnKKllyeKmKGG                         
RICH_MOBI_[GY]:                                                                  YpGlGkwnkkllYekmkGG                         
RICH_MOBI_[HL]:                                                       LHqHLfdpeHdypgL                                        
RICH_MOBI_[IN]:          dNI                                                                                                 
RICH_MOBI_[KL]:                                                                     LgKwnKKLLyeKmK                           
RICH_MOBI_[KR]:                                                                       KwnKKllyeKmKggeRRKRR                   
RICH_MOBI_[KY]:                                                                  YpglgKwnKKllYeKmK                           
RICH_MOBI_[LY]:                                                           LfdpehdYpgLgkwnkkLLY                               
RICH_fLPS_MOBI_[F]:                                          taeFsreFqlhqhlF                                                 
RICH_fLPS_MOBI_[K]:                                                                 lgKwnKKllyeKmKggerrK                     

                                 
AA:                      VPHFSDEDKDPE
STMI:                                
DO_DISOPRED3:            ......DDDDDD
DO_IUPRED2A:             DDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDD
RICH_[D]:                vphfsDeDkD  
RICH_[V]:                V           
RICH_MOBI_[D]:           vphfsDeDkD  
RICH_MOBI_[V]:           V