P09669 COX6C_HUMAN

Gene name: COX6C
Protein name: Cytochrome c oxidase subunit 6C

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

                                           20                  40                  60     
AA:                      MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK
STMI:                                 MMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMMM                     
DO_DISOPRED3:            DDDD.......................................................................
DO_IUPRED2A:             ...........................................................................
DO_SPOTD:                DDDDDDDD...............................................................DDDD
CONSENSUS:               DDDD.........                                         .....................
CONSENSUS_MOBI:          .............                                         .....................