P0DJ07 PT100_HUMAN

Gene name: PET100
Protein name: Protein PET100 homolog, mitochondrial

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

                                           20                  40                  60       
AA:                      MGVKLEIFRMIIYLTFPVAMFWVSNQAEWFEDDVIQRKRELWPPEKLQEIEEFKERLRKRREEKLLRDAQQNS
STMI:                          MMMMMMMMMMMMMMMMMM                                                 
DO_DISOPRED3:            D......................................................................DD
DO_IUPRED2A:             .........................................................................
DO_SPOTD:                .............................................................DDDDDDDDDDDD
CONSENSUS:               ......                  ...............................................DD
CONSENSUS_MOBI:          ......                  .................................................