P0DJ93 SIM13_HUMAN

Gene name: SMIM13
Protein name: Small integral membrane protein 13

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9BQ52 ELAC2 0.65727 cellular nitrogen compound metabolic process GO:0034641
2 A8K010 LINC00473 0.65159 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
3 Q96M61 MAGEB18 0.63668
4 Q86V25 VASH2 0.63482 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
5 Q9BWT1 CDCA7 0.63331 biosynthetic process GO:0009058
cell death GO:0008219
cell population proliferation GO:0008283
...
6 Q13009 TIAM1 0.62877 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell death GO:0008219
...
7 Q8N539 FIBCD1 0.6229
8 O15481 MAGEB4 0.62016
9 B3KS81 SRRM5 0.6169
10 Q9NVD3 SETD4 0.61622 cellular protein modification process GO:0006464

                                           20                  40                  60                  80         
AA:                      MWHSVGLTLLVFVATLLIVLLLMVCGWYFVWHLFLSKFKFLRELVGDTGSQEGDHEPSGSETEEDTSSSPHRIRSARQRRAPADEGHRPLT
STMI:                             MMMMMMMMMMMMMMMMMMMMM                                                             
DO_DISOPRED3:            ....DDDDDDDDDDDDDDD.................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ................................................D.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDD..........................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               .........                     ..................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .........                     ................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[AR]:                                                                                        RsARqRRApA        
RICH_[E]:                                                                   EgdhEpsgsEtEE                           
RICH_[R]:                                                                                       RiRsaRqRRapadeghR   
RICH_[S]:                                                                 SqegdhepSgSeteedtSSS                      
RICH_[ES]:                                                                SqEgdhEpSgSEtEEdtSSS                      
RICH_fLPS_[R]:                                                                               sphRiRsaRqRRapadeghR   
RICH_MOBI_[AR]:                                                                                   RsARqRRApA        
RICH_MOBI_[E]:                                                              EgdhEpsgsEtEE                           
RICH_MOBI_[R]:                                                                                  RiRsaRqRRapadeghR   
RICH_MOBI_[ES]:                                                           SqEgdhEpSgSEtEEdtSSS                      
RICH_fLPS_MOBI_[R]:                                                                            hRiRsaRqRR