P0DJI9 SAA2_HUMAN

Gene name: SAA2
Protein name: Serum amyloid A-2 protein

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q96EL3 MRPL53 0.89443 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
translation GO:0006412
2 Q8WWH4 ASZ1 0.89443
3 Q7Z601 GPR142 0.79765
4 Q6XR72 SLC30A10 0.77702 biosynthetic process GO:0009058
cell death GO:0008219
cellular protein modification process GO:0006464
...
5 Q9UL18 AGO1 0.74786 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
6 Q9H6U8 ALG9 0.74683 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
7 Q96HS1 PGAM5 0.72868 catabolic process GO:0009056
cell death GO:0008219
homeostatic process GO:0042592
8 P06396 GSN 0.72171 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
cell adhesion GO:0007155
...
9 Q01433 AMPD2 0.71374 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
homeostatic process GO:0042592
...
10 Q6ICL7 SLC35E4 0.70273

                                           20                  40                  60                  80                 100
AA:                      MKLLTGLVFCSLVLSVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISNARENIQRLTGRGAEDSLADQAA
STMI:                    SSSSSSSSSSSSSSSSSS                                                                                  
DO_DISOPRED3:            DDDDDDDDDD..........................................................................................
DO_IUPRED2A:             ......................................................................................DD..D.....D.DD
DO_SPOTD:                ....................................................................................................
CONSENSUS:                                 ..................................................................................
CONSENSUS_MOBI:                            .....................................................................DDDDDDDDDDDDD
RICH_MOBI_[AG]:                                                                                                 GrGAedslAdqAA
RICH_MOBI_[A]:                                                                                                     AedslAdqAA

                                          120                  
AA:                      NKWGRSGRDPNHFRPAGLPEKY
STMI:                                          
DO_DISOPRED3:            ......................
DO_IUPRED2A:             DD..DDDDDDD..DDDDDDD..
DO_SPOTD:                ...DDDDDDDD.....D.DDDD
CONSENSUS:               ....DDDDDDD.....D.DD..
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDD
RICH_MOBI_[AG]:          nkwGrsG