P0DMW2 PYDC4_HUMAN
Gene name: NLRP2B
Protein name: NLR family pyrin domain-containing protein 2B
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
20 40 AA: MVSSAQLDFNLQALLGQLSQDDLCKFKSLIRTVSLGNELQKIPQT STMI: DO_DISOPRED3: DDD.........................................D DO_IUPRED2A: ............................................. DO_SPOTD: DDDDDD...............................DDDDDDDD CONSENSUS: DDD.........................................D CONSENSUS_MOBI: .............................................