P10124 SRGN_HUMAN

Gene name: SRGN
Protein name: Serglycin

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell death GO:0008219
- cell junction organization GO:0034330
- cell-cell signaling GO:0007267
- protein maturation GO:0051604
- protein transport GO:0015031
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q32M45 ANO4 0.78604 membrane organization GO:0061024
plasma membrane organization GO:0007009
transmembrane transport GO:0055085
...
2 P55899 FCGRT 0.75141 immune system process GO:0002376
transport GO:0006810
vesicle-mediated transport GO:0016192
3 Q9NS61 KCNIP2 0.58394 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell-cell signaling GO:0007267
...
4 Q9UGR2 ZC3H7B 0.58037 biological process involved in symbiotic interaction GO:0044403
cellular nitrogen compound metabolic process GO:0034641
5 Q9Y2X7 GIT1 0.57471 cell cycle GO:0007049
cell division GO:0051301
cell-cell signaling GO:0007267
...
6 P0C0L4 C4A 0.57324 cellular protein modification process GO:0006464
immune system process GO:0002376
response to stress GO:0006950
...
7 Q495M9 USH1G 0.57069 anatomical structure development GO:0048856
cell differentiation GO:0030154
embryo development GO:0009790
...
8 Q9BQI7 PSD2 0.55822 signal transduction GO:0007165
9 Q6UX71 PLXDC2 0.5581
10 A2RU67 FAM234B 0.55742

                                           20                  40                  60                  80                 100
AA:                      MMQKLLKCSRLVLALALILVLESSVQGYPTRRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGS
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSSSSS                                                                         
DO_DISOPRED3:            DDDDDDDDDDDDDDD..DD......................................................................DDDDDDDDDDD
DO_IUPRED2A:             ............................................................D.........D..........................DDD
DO_SPOTD:                DDDDDDD..................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                                          .................................D.........D..................DDDDDDDDDDD
CONSENSUS_MOBI:                                     .........................................................................
RICH_[G]:                                                                                                              GsGfGs
RICH_[S]:                                                                                                         SedySgSgfgS
RICH_[FG]:                                                                                                                FGs
RICH_[FS]:                                                                                                                FgS
RICH_[GS]:                                                                                                        SedySGSGfGS
RICH_fLPS_[S]:                                                                                                    SedySgSgfgS
RICH_fLPS_[G]:                                                                                                      dysGsGfGs
RICH_fLPS_[GS]:                                                                                                       SGSGfGS

                                          120                 140  
AA:                      GSGSGSGSGSGFLTEMEQDYQLVDESDAFHDNLRSLDRNLPSDSQDLGQHGLEEDFML
STMI:                                                                              
DO_DISOPRED3:            DDDDDDDDDDDD...............................DDDDDDDDDDDDDDD
DO_IUPRED2A:             D...D.DDDDDD..DDD......DD.......DDDDDDDDDDDDDDDDDDDDD.....
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDD......DD.......DDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .................................DDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[D]:                                                    DrnlpsDsqDlgqhgleeD   
RICH_[G]:                GsGsGsGsGsG                                               
RICH_[S]:                gSgSgSgSgS                                                
RICH_[DL]:                                                  LDrnLpsDsqDLgqhgLeeD   
RICH_[FG]:               GsGsGsGsGsGF                                              
RICH_[FS]:               gSgSgSgSgSgF                                              
RICH_[GS]:               GSGSGSGSGSG                                               
RICH_fLPS_[S]:           gSgSgSgSgS                                                
RICH_fLPS_[G]:           GsGsGsGsGsG                                               
RICH_fLPS_[GS]:          GSGSGSGSGSG                                               
RICH_MOBI_[D]:                                               DrnlpsDsqDlgqhgleeD   
RICH_MOBI_[L]:                                              LdrnLpsdsqdLgqhgL      
RICH_MOBI_[DL]:                                             LDrnLpsDsqDLgqhgLeeD