P12272 PTHR_HUMAN

Gene name: PTHLH
Protein name: Parathyroid hormone-related protein

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- reproduction GO:0000003
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 D6RCP7 USP17L19 0.62688 catabolic process GO:0009056
cell death GO:0008219
cellular protein modification process GO:0006464
2 D6RA61 USP17L22 0.62584 catabolic process GO:0009056
cell death GO:0008219
cellular protein modification process GO:0006464
3 C9JPN9 USP17L12 0.62525 catabolic process GO:0009056
cell death GO:0008219
cellular protein modification process GO:0006464
4 Q96C36 PYCR2 0.57932 biosynthetic process GO:0009058
response to stress GO:0006950
small molecule metabolic process GO:0044281
5 D6R901 USP17L21 0.56896 catabolic process GO:0009056
cell death GO:0008219
cellular protein modification process GO:0006464
6 Q0WX57 USP17L24 0.56874 catabolic process GO:0009056
cell death GO:0008219
cellular protein modification process GO:0006464
7 D6RBQ6 USP17L17 0.56863 catabolic process GO:0009056
cell death GO:0008219
cellular protein modification process GO:0006464
8 Q8IYB8 SUPV3L1 0.5623 anatomical structure development GO:0048856
catabolic process GO:0009056
cell death GO:0008219
...
9 Q96FI4 NEIL1 0.54906 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...
10 Q15629 TRAM1 0.54769 biological process involved in symbiotic interaction GO:0044403
protein targeting GO:0006605
protein transport GO:0015031
...

                                           20                  40                  60                  80                 100
AA:                      MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDE
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSS                                                                            
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................DDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ..............................DD.....DDDDDD.DDD.......................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDD..................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                                       DDDDDDDDDDDDDDDDDDDDDDD.......................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:                                  ...........D..................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[N]:                                                                                                NskpspNtkN          
RICH_[R]:                                        RsveglsRRlkR                                                                
RICH_[EY]:                                                                                                                  E
RICH_[LR]:                                       RsvegLsRRLkRavsehqLL                                                        
RICH_MOBI_[N]:                                                                                           NskpspNtkN          

                                          120                 140                 160   
AA:                      GRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSRRH
STMI:                                                                                                 
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DD............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[K]:                         KvetyKeqplKtpgKKKKgKpgKrKeqeKKK                                     
RICH_[R]:                                                RkeqekkkRRtR                                 
RICH_[T]:                    TqeTnkveTykeqplkT                               TgsglegdhlsdTsTT         
RICH_[TY]:                 YlTqeTnkveTYkeqplkT                                                        
RICH_[EY]:               grYltqEtnkvEtYkE                                                             
RICH_[GK]:                                     GKKKKGKpGK                                             
RICH_[GT]:                                                                 GvTGsGleGdhlsdTsTT         
RICH_[KR]:                                       KKKgKpgKRKeqeKKKRRtR                                 
RICH_[KT]:                   TqeTnKveTyKeqplKTpgK                                                     
RICH_[LT]:                                                                   TgsgLegdhLsdTsTTsLeL     
RICH_fLPS_[K]:                              KtpgKKKKgKpgKrKeqeKKK                                     
RICH_MOBI_[L]:                                                                   LegdhLsdtsttsLeL     
RICH_MOBI_[R]:                                           RkeqekkkRRtR                                 
RICH_MOBI_[T]:                                                               TgsglegdhlsdTsTT         
RICH_MOBI_[DL]:                                                                     DhLsDtsttsLeLD    
RICH_MOBI_[GT]:                                                            GvTGsGleGdhlsdTsTT         
RICH_MOBI_[KR]:                                         KRKeqeKKKRRtR                                 
RICH_MOBI_[LT]:                                                              TgsgLegdhLsdTsTTsLeL     
RICH_fLPS_MOBI_[K]:                                    gKrKeqeKKK