P15954 COX7C_HUMAN
Gene name: COX7C
Protein name: Cytochrome c oxidase subunit 7C, mitochondrial
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
20 40 60 AA: MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLLKT STMI: TTTTTTTTTTTTTTTT MMMMMMMMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DD............................................................. DO_IUPRED2A: ............................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDD....................................... CONSENSUS: ................. ... CONSENSUS_MOBI: ................. ...