P21291 CSRP1_HUMAN
Gene name: CSRP1
Protein name: Cysteine and glycine-rich protein 1
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- cell adhesion GO:0007155
- cell differentiation GO:0030154
- cellular component assembly GO:0022607
- cytoskeleton organization GO:0007010
- response to stress GO:0006950
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9H2U1 | DHX36 | 0.82041 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 2 | A8MV23 | SERPINE3 | 0.79037 | |
| 3 | Q9UIG8 | SLCO3A1 | 0.7723 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 4 | P31276 | HOXC13 | 0.77065 | anatomical structure development GO:0048856 |
| 5 | Q6XUX3 | DSTYK | 0.76845 | cell death GO:0008219 cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 6 | Q15477 | SKIV2L | 0.74696 | catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 nucleobase-containing compound catabolic process GO:0034655 |
| 7 | Q9UKL4 | GJD2 | 0.74508 | cell-cell signaling GO:0007267 nervous system process GO:0050877 |
| 8 | Q8IV45 | UNC5CL | 0.7422 | cellular protein modification process GO:0006464 response to stress GO:0006950 signal transduction GO:0007165 |
| 9 | Q9NXD2 | MTMR10 | 0.74119 | |
| 10 | Q8N7G0 | POU5F2 | 0.73815 | biosynthetic process GO:0009058 cell differentiation GO:0030154 cellular nitrogen compound metabolic process GO:0034641 |
20 40 60 80 100 AA: MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRP STMI: DO_DISOPRED3: DDDD................................................................................................ DO_IUPRED2A: .......................................................................................DDDDDDDDDDDDD DO_SPOTD: DDDDDDD...........................................................................DDDDDDDDDDDDDDDDDD CONSENSUS: DDDD...................................................................................DDDDDDDDDDDDD CONSENSUS_MOBI: ..................................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD RICH_MOBI_[G]: GpkGyGyGqGaGtlstdkGeslG RICH_MOBI_[GY]: GpkGYGYGqGaGtlstdkGeslG RICH_fLPS_MOBI_[G]: GpkGyGyGqGaGtlstdkGeslG
120 140 160 180 AA: TTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE STMI: DO_DISOPRED3: ...........................................................................................DD DO_IUPRED2A: DDDDDDDD..................................................................................... DO_SPOTD: DDDDDDDDD.................................................................................... CONSENSUS: DDDDDDDD..................................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDD.............................................................................