P23435 CBLN1_HUMAN
Gene name: CBLN1
Protein name: Cerebellin-1
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- cell adhesion GO:0007155
- cell differentiation GO:0030154
- cell junction organization GO:0034330
- cell-cell signaling GO:0007267
- cellular component assembly GO:0022607
- nervous system process GO:0050877
- protein transport GO:0015031
- signal transduction GO:0007165
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9NWN3 | FBXO34 | 0.3575 | |
| 2 | P62491 | RAB11A | 0.29067 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell differentiation GO:0030154 ... |
| 3 | P32926 | DSG3 | 0.27215 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell death GO:0008219 ... |
| 4 | Q8TDD5 | MCOLN3 | 0.23568 | anatomical structure development GO:0048856 cell differentiation GO:0030154 transmembrane transport GO:0055085 ... |
| 5 | Q8N983 | MRPL43 | 0.21924 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 6 | Q9UHN1 | POLG2 | 0.17189 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
| 7 | P61328 | FGF12 | 0.15975 | anatomical structure development GO:0048856 cell-cell signaling GO:0007267 cellular protein modification process GO:0006464 ... |
| 8 | Q13472 | TOP3A | 0.15938 | biosynthetic process GO:0009058 cell cycle GO:0007049 cellular nitrogen compound metabolic process GO:0034641 ... |
| 9 | P26012 | ITGB8 | 0.13997 | |
| 10 | Q9UBS5 | GABBR1 | 0.11917 | cell-cell signaling GO:0007267 signal transduction GO:0007165 |
20 40 60 80 100 AA: MLGVLELLLLGAAWLAGPARGQNETEPIVLEGKCLVVCDSNPTSDPTGTALGISVRSGSAKVAFSAIRSTNHEPSEMSNRTMIIYFDQVLVNIGNNFDSE STMI: SSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDD.....DDDD........................DDDDDDDDDDDDDDDD........................................... DO_IUPRED2A: ................................................DDD................................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDDDDDDDDDDDDDDDDDDDDDDDD........................................... CONSENSUS: ....................DDDDDDDDDDDDDDDD........................................... CONSENSUS_MOBI: ..DDDDDDDDDDDDDDDDDDDDDDDDDDD.DDD.............................................. RICH_MOBI_[CV]: VlegkClVVC
120 140 160 180 AA: RSTFIAPRKGIYSFNFHVVKVYNRQTIQVSLMLNGWPVISAFAGDQDVTREAASNGVLIQMEKGDRAYLKLERGNLMGGWKYSTFSGFLVFPL STMI: DO_DISOPRED3: ............................................................................................. DO_IUPRED2A: ............................................................................................. DO_SPOTD: ............................................................................................. CONSENSUS: ............................................................................................. CONSENSUS_MOBI: .............................................................................................