P23763 VAMP1_HUMAN

Gene name: VAMP1
Protein name: Vesicle-associated membrane protein 1

List of terms from Generic GO subset, which this protein is a part of:
- cell-cell signaling GO:0007267
- cellular component assembly GO:0022607
- membrane organization GO:0061024
- protein-containing complex assembly GO:0065003
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q7Z7M0 MEGF8 0.83507 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...
2 Q6IPT2 FAM71E1 0.82956
3 Q14332 FZD2 0.8164 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
4 Q9H1Z9 TSPAN10 0.81033
5 Q9H1B7 IRF2BPL 0.80767 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
...
6 Q16478 GRIK5 0.80104 cell death GO:0008219
cell-cell signaling GO:0007267
homeostatic process GO:0042592
...
7 Q86T03 PIP4P1 0.79731 cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
response to stress GO:0006950
...
8 Q92623 TTC9 0.78859 anatomical structure development GO:0048856
9 Q8N6N2 TTC9B 0.78163
10 Q6ZSJ8 C1orf122 0.77758

                                           20                  40                  60                  80                 100
AA:                      MSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKMMIM
STMI:                                                                                                                    MMMM
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............................DD................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............................................................DDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................................    
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................    
RICH_[AG]:                 ApAqppAeGteGtApGGG                                                                                
RICH_[AP]:                 APAqPPAegtegtAPgggPP                                                                              
RICH_[G]:                          GteGtapGGGppG                                                                             
RICH_[P]:                   PaqPPaegtegtaPgggPPgPPP                                                                          
RICH_[GP]:                  PaqPPaeGteGtaPGGGPPGPPP                                                                          
RICH_[NP]:                                    PgPPPNmtsN                                                                     
RICH_fLPS_[P]:                 PPaegtegtaPgggPPgPPP                                                                          
RICH_fLPS_[G]:                   aeGteGtapGGGppG                                                                             
RICH_fLPS_[PG]:                    GteGtaPGGGPPGPPP                                                                          
RICH_MOBI_[AG]:            ApAqppAeGteGtApGGG                                                                                
RICH_MOBI_[AP]:            APAqPPAegtegtAPgggPP                                                                              
RICH_MOBI_[G]:                     GteGtapGGGppG                                                                             
RICH_MOBI_[P]:              PaqPPaegtegtaPgggPPgPPP                                                                          
RICH_MOBI_[GP]:             PaqPPaeGteGtaPGGGPPGPPP                                                                          
RICH_MOBI_[NP]:                               PgPPPNmtsN                                                                     
RICH_fLPS_MOBI_[P]:                      PgggPPgPPP                                                                          
RICH_fLPS_MOBI_[G]:              aeGteGtapGGGppG                                                                             

                           
AA:                      LGAICAIIVVVIVIYFFT
STMI:                    MMMMMMMMMMMMMMMM  
DO_DISOPRED3:            ...DDDD..DDDDDDD.D
DO_IUPRED2A:             ..................
DO_SPOTD:                ..DDDDDDDDDDDDDDDD
CONSENSUS:                               .D
CONSENSUS_MOBI:                          ..