P24310 CX7A1_HUMAN

Gene name: COX7A1
Protein name: Cytochrome c oxidase subunit 7A1, mitochondrial

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

                                           20                  40                  60 
AA:                      MQALRVSQALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVTMTLCLGGTVYSLYSLGWASFPRN
STMI:                    TTTTTTTTTTTTTTTTTTTTT                         MMMMMMMMMMMMMMMMMMMMMMMMMMMMM    
DO_DISOPRED3:            DDDDDDDDDDDDDDDD...............................................................
DO_IUPRED2A:             ...............................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDD........................................................DD
CONSENSUS:                                    .........................                             ....
CONSENSUS_MOBI:                               .........................                             ....