P26885 FKBP2_HUMAN
Gene name: FKBP2
Protein name: Peptidyl-prolyl cis-trans isomerase FKBP2
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P51398 | DAP3 | 0.97439 | biosynthetic process GO:0009058 cell death GO:0008219 cellular nitrogen compound metabolic process GO:0034641 ... |
| 2 | Q9C040 | TRIM2 | 0.82365 | catabolic process GO:0009056 cell death GO:0008219 cellular protein modification process GO:0006464 |
| 3 | Q5HYK9 | ZNF667 | 0.78639 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 4 | O95260 | ATE1 | 0.76718 | catabolic process GO:0009056 cellular protein modification process GO:0006464 |
| 5 | Q9P0V8 | SLAMF8 | 0.70711 | anatomical structure development GO:0048856 cell differentiation GO:0030154 homeostatic process GO:0042592 ... |
| 6 | Q29980 | MICB | 0.70366 | biological process involved in symbiotic interaction GO:0044403 immune system process GO:0002376 response to stress GO:0006950 ... |
| 7 | Q6AZW8 | ZNF660 | 0.68112 | |
| 8 | Q6ZN84 | CCDC81 | 0.65223 | |
| 9 | Q13772 | NCOA4 | 0.64977 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
| 10 | Q96PP4 | TSGA13 | 0.63467 |
20 40 60 80 100 AA: MRLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGE STMI: SSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDD........................................................................... DO_IUPRED2A: ................................................................D................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... CONSENSUS: DDDD........................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDD............................................................ RICH_MOBI_[K]: KrKlqigvKK RICH_MOBI_[KV]: KlqigVKKrV
120 140 AA: KRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL STMI: DO_DISOPRED3: .........................................D DO_IUPRED2A: ...............DD......................... DO_SPOTD: ......................................DDDD CONSENSUS: .........................................D CONSENSUS_MOBI: ..........................................