List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell death GO:0008219
- cell differentiation GO:0030154
- cell-cell signaling GO:0007267
- homeostatic process GO:0042592
- immune system process GO:0002376
- membrane organization GO:0061024
- response to stress GO:0006950
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

                                           20                  40                  60                  80              
AA:                      MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
STMI:                    SSSSSSSSSSSSSSSSSS     MMMMMMMMMMMMMMMMMMMMM                                          
DO_DISOPRED3:            DDDDDDDDDDDDDD.D....................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ...........................................................................DDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDD...............................DDDDDDDDDDDDDD...D.DDDDDDDDDDDDDDDDDD
CONSENSUS:                                 .....                     ........DDDDDDDDDDDDDDD.DDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:                            .....                     DDDDDDDDDDDDDDDD..........................