P32245 MC4R_HUMAN
Gene name: MC4R
Protein name: Melanocortin receptor 4
List of terms from Generic GO subset, which this protein is a part of:
- cell-cell signaling GO:0007267
- generation of precursor metabolites and energy GO:0006091
- homeostatic process GO:0042592
- protein transport GO:0015031
- signal transduction GO:0007165
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6P179 | ERAP2 | 0.70711 | catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 circulatory system process GO:0003013 ... |
| 2 | Q8TBF8 | FAM81A | 0.49725 | |
| 3 | Q32ZL2 | PLPPR5 | 0.40896 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular component assembly GO:0022607 ... |
| 4 | P16473 | TSHR | 0.39014 | cell population proliferation GO:0008283 cell-cell signaling GO:0007267 homeostatic process GO:0042592 ... |
| 5 | Q9HCJ2 | LRRC4C | 0.30883 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 6 | P41743 | PRKCI | 0.3058 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 7 | Q86SQ7 | SDCCAG8 | 0.28788 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell cycle GO:0007049 ... |
| 8 | P10600 | TGFB3 | 0.28776 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 9 | A6NGB7 | TMEM221 | 0.28079 | |
| 10 | Q15319 | POU4F3 | 0.27315 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
20 40 60 80 100 AA: MVNSTHRGMHTSLHLWNRSSYRLHSNASESLGKGYSDGGCYEQLFVSPEVFVTLGVISLLENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSNGSE STMI: MMMMMMMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDDD............................................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDD..................................................................................... CONSENSUS: DDDDDDDDDDDDDDD............................ ............ CONSENSUS_MOBI: ........................................... ............ RICH_[HM]: MvnstHrgMHtslH
120 140 160 180 200 AA: TIVITLLNSTDTDAQSFTVNIDNVIDSVICSSLLASICSLLSIAVDRYFTIFYALQYHNIMTVKRVGIIISCIWAACTVSGILFIIYSDSSAVIICLITM STMI: MMMMMM MMMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: ................. .................... ..... CONSENSUS_MOBI: ................. .................... .....
220 240 260 280 300 AA: FFTMLALMASLYVHMFLMARLHIKRIAVLPGTGAIRQGANMKGAITLTILIGVFVVCWAPFFLHLIFYISCPQNPYCVCFMSHFNLYLILIMCNSIIDPL STMI: MMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: ..........................DDDDDDDDDDDDD............................................................. CONSENSUS: ................................. ......... CONSENSUS_MOBI: ................................. .........
320 AA: IYALRSQELRKTFKEIICCYPLGGLCDLSSRY STMI: MMMM DO_DISOPRED3: ......................DDDDDDDDDD DO_IUPRED2A: ................................ DO_SPOTD: .......................DDDDDDDDD CONSENSUS: ...................DDDDDDDDD CONSENSUS_MOBI: ............................