P37840 SYUA_HUMAN

Gene name: SNCA
Protein name: Alpha-synuclein

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- carbohydrate metabolic process GO:0005975
- catabolic process GO:0009056
- cell death GO:0008219
- cell junction organization GO:0034330
- cell-cell signaling GO:0007267
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- chromosome organization GO:0051276
- cytoskeleton organization GO:0007010
- generation of precursor metabolites and energy GO:0006091
- homeostatic process GO:0042592
- immune system process GO:0002376
- membrane organization GO:0061024
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
- transmembrane transport GO:0055085
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P35609 ACTN2 0.90818 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell adhesion GO:0007155
...
2 Q0VD86 INCA1 0.72494 cell cycle GO:0007049
cell death GO:0008219
cell population proliferation GO:0008283
...
3 Q9Y487 ATP6V0A2 0.68478 catabolic process GO:0009056
homeostatic process GO:0042592
immune system process GO:0002376
...
4 Q9NZA1 CLIC5 0.66549 nervous system process GO:0050877
reproduction GO:0000003
transmembrane transport GO:0055085
...
5 Q7L4P6 BEND5 0.63519 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
6 Q9UKW4 VAV3 0.58907 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell adhesion GO:0007155
...
7 Q9Y217 MTMR6 0.56871 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
transport GO:0006810
...
8 Q5GH77 XKR3 0.55372
9 P09912 IFI6 0.54573 cell death GO:0008219
homeostatic process GO:0042592
immune system process GO:0002376
...
10 P46091 GPR1 0.53939 signal transduction GO:0007165

                                           20                  40                  60                  80                 100
AA:                      MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQL
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDD....DDDDDDDDDDDDDD..........................................................DDDDD
DO_IUPRED2A:             .........................DDD......................DDDDDD..DD......................................DD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDD....DDDDDDDDDDDDDD.............DDDDDDDDDD...................................DDDDD
CONSENSUS_MOBI:          ....................................................................................................

                                          120
AA:                      GKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
STMI:                                                            
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ........................................
RICH_[E]:                                      EayEmpsEEgyqdyEpE 
RICH_[Y]:                                        YempseegYqdY    
RICH_[DM]:                             DMpvDpDneayeM             
RICH_[EY]:                            EdmpvdpdnEaYEmpsEEgYqdYEpE 
RICH_fLPS_[Y]:                                neaYempseegYqdY