P43359 MAGA5_HUMAN

Gene name: MAGEA5
Protein name: Melanoma-associated antigen 5

List of terms from Generic GO subset, which this protein is a part of:
- chromosome segregation GO:0007059

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8IY50 SLC35F3 0.77265 transport GO:0006810
2 Q96NY9 MUS81 0.6932 catabolic process GO:0009056
cell cycle GO:0007049
cell population proliferation GO:0008283
...
3 Q8NI29 FBXO27 0.64116 catabolic process GO:0009056
cellular protein modification process GO:0006464
response to stress GO:0006950
4 P13051 UNG 0.63158 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
5 Q9H3U5 MFSD1 0.62975
6 Q9Y5Y0 FLVCR1 0.6238 anatomical structure development GO:0048856
cell differentiation GO:0030154
developmental maturation GO:0021700
...
7 Q14764 MVP 0.61643 cellular protein modification process GO:0006464
immune system process GO:0002376
protein transport GO:0015031
...
8 A1A5B4 ANO9 0.6132 membrane organization GO:0061024
plasma membrane organization GO:0007009
transmembrane transport GO:0055085
...
9 O15427 SLC16A3 0.59146 immune system process GO:0002376
small molecule metabolic process GO:0044281
transmembrane transport GO:0055085
...
10 Q6P1M3 LLGL2 0.58993 cell cycle GO:0007049
cell division GO:0051301
cytoskeleton organization GO:0007010
...

                                           20                  40                  60                  80                 100
AA:                      MSLEQKSQHCKPEEGLDTQEEALGLVGVQAATTEEQEAVSSSSPLVPGTLGEVPAAGSPGPLKSPQGASAIPTAIDFTLWRQSIKGSSNQEEEGPSTSPD
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDD.......DDDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............DDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............DDDDDDDDDDDDDDDDDDD
RICH_[AE]:                                  EEAlglvgvqAAttEEqEA                                                              
RICH_[AG]:                                                                 GevpAAGspGplkspqGAsA                              
RICH_[AP]:                                                                    PAAgsPgPlksPqgAsAiPtA                          
RICH_[I]:                                                                                      IptaIdftlwrqsI                
RICH_[ES]:                                                EEqEavSSSS                                                         
RICH_[GP]:                                                          PlvPGtlGevPaaGsPGPlksPqG                                 
RICH_MOBI_[AE]:                             EEAlglvgvqAAttEEqEA                                                              
RICH_MOBI_[AV]:                               AlglVgVqAA                                                                     

                                          120                
AA:                      PESVFRAALSKKVADLIHFLLLKY
STMI:                                            
DO_DISOPRED3:            D.......................
DO_IUPRED2A:             DDDDDD..................
DO_SPOTD:                DDD.....................
CONSENSUS:               DDD.....................
CONSENSUS_MOBI:          DDD.....................