P43487 RANG_HUMAN
Gene name: RANBP1
Protein name: Ran-specific GTPase-activating protein
List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- cell cycle GO:0007049
- cytoskeleton organization GO:0007010
- mitotic cell cycle GO:0000278
- mitotic nuclear division GO:0140014
- signal transduction GO:0007165
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9H4A5 | GOLPH3L | 0.69799 | membrane organization GO:0061024 protein transport GO:0015031 transport GO:0006810 ... |
| 2 | Q9HAW4 | CLSPN | 0.66755 | biosynthetic process GO:0009058 cell cycle GO:0007049 cellular nitrogen compound metabolic process GO:0034641 ... |
| 3 | P19338 | NCL | 0.6627 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 4 | Q9HAU5 | UPF2 | 0.6617 | anatomical structure development GO:0048856 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 5 | Q96T23 | RSF1 | 0.65075 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 cellular component assembly GO:0022607 ... |
| 6 | Q99442 | SEC62 | 0.65002 | protein targeting GO:0006605 protein transport GO:0015031 transmembrane transport GO:0055085 ... |
| 7 | Q8IZP2 | ST13P4 | 0.64819 | cellular component assembly GO:0022607 protein folding GO:0006457 protein-containing complex assembly GO:0065003 |
| 8 | Q9HC10 | OTOF | 0.64719 | cell-cell signaling GO:0007267 cellular component assembly GO:0022607 membrane organization GO:0061024 ... |
| 9 | P14625 | HSP90B1 | 0.64651 | catabolic process GO:0009056 cell death GO:0008219 cellular component assembly GO:0022607 ... |
| 10 | Q13045 | FLII | 0.64172 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
20 40 60 80 100 AA: MAAAKDTHEDHDTSTENTDESNHDPQFEPIVSLPEQEIKTLEEDEEELFKMRAKLFRFASENDLPEWKERGTGDVKLLKHKEKGAIRLLMRRDKTLKICA STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDD........................DDDDDDD......................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDD............................................................................... RICH_[AH]: AAAkdtHedH RICH_[D]: DtheDhDtstentDesnhD RICH_[T]: ThedhdTsTenT RICH_[DE]: EDhDtstEntDEsnhDpqfE RICH_[DH]: DtHeDHDtstentDesnHD RICH_[DT]: DTheDhDTsTenTDesnhD RICH_[NT]: TsTeNTdesN RICH_MOBI_[AH]: AAAkdtHedH RICH_MOBI_[D]: DtheDhDtstentD RICH_MOBI_[T]: ThedhdTsTenT RICH_MOBI_[DH]: DtHeDHDtstentD RICH_MOBI_[DT]: DTheDhDTsTenTD
120 140 160 180 200 AA: NHYITPMMELKPNAGSDRAWVWNTHADFADECPKPELLAIRFLNAENAQKFKTKFEECRKEIEEREKKAGSGKNDHAEKVAEKLEALSVKEETKEDAEEK STMI: DO_DISOPRED3: ..................................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ......DDDDD...DDD............................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_SPOTD: .................................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: .................................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ...................................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD RICH_[AE]: AEkvAEklEA RICH_[AK]: KKAgsgKndhAeKvAeKleA RICH_[E]: EkvaEklEalsvkEEtkEdaEE RICH_[K]: KKagsgKndhaeKvaeK RICH_[EK]: EKKagsgKndhaEKvaEKlE RICH_fLPS_[E]: vaEklEalsvkEEtkEdaEE RICH_MOBI_[AK]: KAgsgKndhAeKvAeKleA RICH_MOBI_[E]: EkvaEklEalsvkEEtkEdaEE RICH_MOBI_[K]: KagsgKndhaeKvaeK RICH_MOBI_[EK]: KndhaEKvaEKlEalsvKEE
AA: Q STMI: DO_DISOPRED3: D DO_IUPRED2A: D DO_SPOTD: D CONSENSUS: D CONSENSUS_MOBI: D