P45877 PPIC_HUMAN
Gene name: PPIC
Protein name: Peptidyl-prolyl cis-trans isomerase C
List of terms from Generic GO subset, which this protein is a part of:
- cellular protein modification process GO:0006464
- protein folding GO:0006457
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6P1M0 | SLC27A4 | 0.83771 | anatomical structure development GO:0048856 catabolic process GO:0009056 circulatory system process GO:0003013 ... |
| 2 | Q16850 | CYP51A1 | 0.7702 | biosynthetic process GO:0009058 catabolic process GO:0009056 protein transport GO:0015031 ... |
| 3 | Q15165 | PON2 | 0.73487 | catabolic process GO:0009056 response to stress GO:0006950 small molecule metabolic process GO:0044281 |
| 4 | P33261 | CYP2C19 | 0.73456 | catabolic process GO:0009056 small molecule metabolic process GO:0044281 |
| 5 | Q16696 | CYP2A13 | 0.72299 | catabolic process GO:0009056 small molecule metabolic process GO:0044281 |
| 6 | P20853 | CYP2A7 | 0.72299 | catabolic process GO:0009056 small molecule metabolic process GO:0044281 |
| 7 | A1L4L8 | PLAC8L1 | 0.70949 | |
| 8 | P11712 | CYP2C9 | 0.70607 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 9 | O14638 | ENPP3 | 0.68583 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell population proliferation GO:0008283 ... |
| 10 | Q9Y2P5 | SLC27A5 | 0.68167 | biosynthetic process GO:0009058 generation of precursor metabolites and energy GO:0006091 small molecule metabolic process GO:0044281 ... |
20 40 60 80 100 AA: MGPGPRLLLPLVLCVGLGALVFSSGAEGFRKRGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYGYKGSKFHRVIKDFMIQGGD STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................... CONSENSUS_MOBI: .......................DDDDDDDD..................................................................... RICH_[L]: LLLpLvLcvgLgaL RICH_[V]: VlcVglgalV RICH_[GL]: GpGprLLLpLvLcvGLGaL RICH_[LV]: LLLpLVLcVgLgaLV RICH_fLPS_[L]: mgpgprLLLpLvLcvgLgaL
120 140 160 180 200 AA: ITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATDGHDRPLTNCSIINSGKID STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
AA: VKTPFVVEIADW STMI: DO_DISOPRED3: ............ DO_IUPRED2A: ............ DO_SPOTD: ............ CONSENSUS: ............ CONSENSUS_MOBI: ............