P46527 CDN1B_HUMAN

Gene name: CDKN1B
Protein name: Cyclin-dependent kinase inhibitor 1B

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cell cycle GO:0007049
- cell death GO:0008219
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- cytoskeleton organization GO:0007010
- growth GO:0040007
- mitotic cell cycle GO:0000278
- mitotic nuclear division GO:0140014
- nervous system process GO:0050877
- protein-containing complex assembly GO:0065003
- reproduction GO:0000003
- response to stress GO:0006950
- signal transduction GO:0007165
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9UGM5 FETUB 0.65158 reproduction GO:0000003
2 O00505 KPNA3 0.62299 biological process involved in symbiotic interaction GO:0044403
cellular component assembly GO:0022607
nucleocytoplasmic transport GO:0006913
...
3 Q9Y252 RNF6 0.60123 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
4 O75829 CNMD 0.59945 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
5 P41212 ETV6 0.58482 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell death GO:0008219
...
6 Q92988 DLX4 0.58084 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
7 Q99598 TSNAX 0.57773 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular nitrogen compound metabolic process GO:0034641
...
8 O60826 CCDC22 0.56799 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...
9 Q9P2E3 ZNFX1 0.56665 cellular component assembly GO:0022607
chromosome organization GO:0051276
protein-containing complex assembly GO:0065003
10 Q9Y4F5 CEP170B 0.5639

                                           20                  40                  60                  80                 100
AA:                      MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACK
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................DDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDDDDDDDDDDD..DDDDDDDDDD.....DDDDDDDD...DDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........DDDDDD..DDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....DDD........DDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDD........................................................................DDDD
RICH_[PY]:                                                                                                   PefYYrPPrPPkgack
RICH_[P]:                                                                                                    PefyyrPPrPPkgack
RICH_[DH]:                                                   DHeeltrDlekHcrD                                                 

                                          120                 140                 160                 180  
AA:                      VPAQESQDVSGSRPAAPLIGAPANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPNAGSVEQTPKKPGLRRRQT
STMI:                                                                                                                      
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........DDDDDDDD
RICH_[PY]:               vP                                                                                                
RICH_[AP]:                            PAAPligAPAnsedthlvdP                                                                 
RICH_[D]:                                          DthlvDpktDpsD                                                           
RICH_[N]:                                                                               NkraNrteeNvsdgspN                  
RICH_[P]:                vP                                                                                                
RICH_[R]:                                                                   RkRpatddsstqnkRanR                             
RICH_MOBI_[D]:                                     DthlvDpktDpsD                                                           
RICH_MOBI_[N]:                                                                          NkraNrteeNvsdgspN                  
RICH_MOBI_[R]:                                                              RkRpatddsstqnkRanR