P46695 IEX1_HUMAN

Gene name: IER3
Protein name: Radiation-inducible immediate-early gene IEX-1

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell death GO:0008219
- response to stress GO:0006950
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q6UX72 B3GNT9 0.72337 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
cellular protein modification process GO:0006464
2 A6NHQ4 EPOP 0.68642 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
3 Q96K62 ZBTB45 0.67203 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
...
4 O15054 KDM6B 0.67116 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
5 Q5T0Z8 C6orf132 0.67052
6 Q8WXD9 CASKIN1 0.66367 signal transduction GO:0007165
7 E9PAV3 NACA 0.66119 protein targeting GO:0006605
protein transport GO:0015031
transport GO:0006810
8 C9J069 AJM1 0.66089 cell junction organization GO:0034330
9 Q8IUC6 TICAM1 0.65898 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
10 Q96HB5 CCDC120 0.65638 anatomical structure development GO:0048856
cytoskeleton organization GO:0007010

                                           20                  40                  60                  80                 100
AA:                      MCHSRSCHPTMTILQAPTPAPSTIPGPRRGSGPEIFTFDPLPEPAAAPAGRPSASRGHRKRSRRVLYPRVVRRQLPVEEPNPAKRLLFLLLTIVFCQILM
STMI:                                                                                                      MMMMMMMMMMMMMMMMM 
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............DDDDDDDDDDDDDDDDDD......................................
DO_IUPRED2A:             .D......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.D.......D............................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........DDDDDDDDDDDDDDDDDDDDDDDDD..................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........DDDDDDDDDDDDDDDDDDDDDDD..................                 .
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................                 .
RICH_[PR]:                                                        PePaaaPagRPsasRghRkR                                       
RICH_[PT]:                       PTmTilqaPTPaPsTiPgP                                                                         
RICH_[AP]:                                                        PePAAAPAgrPsA                                              
RICH_[AR]:                                                           AAApAgRpsAsRghRkRsRR                                    
RICH_[A]:                                                            AAApAgrpsA                                              
RICH_[P]:                        PtmtilqaPtPaPstiPgP                                                                         
RICH_[R]:                                                                  RpsasRghRkRsRR                                    
RICH_[T]:                         TmTilqapTpapsT                                                                             
RICH_[CP]:                ChsrsChPtmtilqaPtPaP                                                                               
RICH_[IP]:                           IlqaPtPaPstIPgP                                                                         
RICH_fLPS_[A]:                                                       AAApAgrpsA                                              
RICH_MOBI_[PT]:                  PTmTilqaPTPaPsTiPgP                                                                         
RICH_MOBI_[AF]:                                             FtFdplpepAAApAgrpsA                                              
RICH_MOBI_[AP]:                                          PeiftfdPlPePAAAPAgrPsA                                              
RICH_MOBI_[AR]:                                                      AAApAgRpsAsRghRkR                                       
RICH_MOBI_[A]:                                                       AAApAgrpsA                                              
RICH_MOBI_[P]:                   PtmtilqaPtPaPstiPgP     PeiftfdPlPePaaaPagrP                                                
RICH_MOBI_[R]:                                                             RpsasRghRkR                                       
RICH_MOBI_[T]:                    TmTilqapTpapsT                                                                             
RICH_MOBI_[CM]:          MChsrsChptM                                                                                         
RICH_MOBI_[FI]:                                 IpgprrgsgpeIFtF                                                              
RICH_MOBI_[FP]:                                  PgPrrgsgPeiFtFdPlPeP                                                        
RICH_MOBI_[IP]:                  PtmtIlqaPtPaPstIPgP                                                                         
RICH_MOBI_[IT]:                   TmTIlqapTpapsTI                                                                            

                                          120                 140    
AA:                      AEEGVPAPLPPEDAPNAASLAPTPVSAVLEPFNLTSEPSDYALDLSTFLQQHPAAF
STMI:                                                                            
DO_DISOPRED3:            ........................................................
DO_IUPRED2A:             .....DDDDDDDDDDDDDDDD...................................
DO_SPOTD:                ..DDDDDDDDDDDDDDDDDDDDDDDDDDDDD.D.D................DDDDD
CONSENSUS:               .....DDDDDDDDDDDDDDDD...................................
CONSENSUS_MOBI:          ........................................................
RICH_[A]:                      AplppedApnAAslA                                   
RICH_[P]:                     PaPlPPedaP