P47813 IF1AX_HUMAN

Gene name: EIF1AX
Protein name: Eukaryotic translation initiation factor 1A, X-chromosomal

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- translation GO:0006412

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O14602 EIF1AY 0.65046
2 P52429 DGKE 0.63339 biosynthetic process GO:0009058
cell-cell signaling GO:0007267
response to stress GO:0006950
...
3 Q9HCZ1 ZNF334 0.57776 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
4 Q96KB5 PBK 0.56405 catabolic process GO:0009056
cell cycle GO:0007049
cellular protein modification process GO:0006464
...
5 Q05513 PRKCZ 0.55759 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...
6 P32121 ARRB2 0.54684 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
7 O00591 GABRP 0.53805 cell-cell signaling GO:0007267
nervous system process GO:0050877
signal transduction GO:0007165
...
8 Q9UIA0 CYTH4 0.53251 signal transduction GO:0007165
9 Q13576 IQGAP2 0.52108 cellular component assembly GO:0022607
cytoskeleton organization GO:0007010
immune system process GO:0002376
...
10 Q9P272 TRMT9B 0.51819 cellular nitrogen compound metabolic process GO:0034641

                                           20                  40                  60                  80                 100
AA:                      MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEA
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDD................................................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDD.........................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDD.............................................................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDD.............................................................................
CONSENSUS_MOBI:          D...................................................................................................
RICH_[G]:                     GkGGknrrrG                                                                                     
RICH_[K]:                  KnKgKggKnrrrgKneneseK                                                                             
RICH_[N]:                   NkgkggkNrrrgkNeN                                                                                 
RICH_[GK]:                 KnKGKGGKnrrrGKneneseK                                                                             
RICH_[GN]:                  NkGkGGkNrrrGkNeN                                                                                 
RICH_[GR]:                    GkGGknRRRG                                                                                     
RICH_[KN]:                 KNKgKggKNrrrgKNeNeseK                                                                             
RICH_[KR]:                   KgKggKnRRR                                                                                      

                                          120                 140                
AA:                      RSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI
STMI:                                                                
DO_DISOPRED3:            ......................DDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             .............DDDDDDDDDD..DDDDD.DD...........
DO_SPOTD:                ...........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               .............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ............................................
RICH_[D]:                                  DtfgpgDDDeiqfDDigDDDeDiDD 
RICH_[I]:                                            IqfddIgdddedIddI
RICH_[DF]:                                 DtFgpgDDDeiqFDD           
RICH_[DI]:                             InetDtfgpgDDDeIqfDDIgDDDeDIDDI
RICH_fLPS_[D]:                                  gDDDeiqfDDigDDDeDiDD