P47928 ID4_HUMAN

Gene name: ID4
Protein name: DNA-binding protein inhibitor ID-4

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell cycle GO:0007049
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cellular nitrogen compound metabolic process GO:0034641
- mitotic cell cycle GO:0000278
- reproduction GO:0000003

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q6ZRI0 OTOG 0.70481 carbohydrate metabolic process GO:0005975
nervous system process GO:0050877
small molecule metabolic process GO:0044281
2 E9PAV3 NACA 0.69498 protein targeting GO:0006605
protein transport GO:0015031
transport GO:0006810
3 Q99946 PRRT1 0.68711
4 Q96CT2 KLHL29 0.67723
5 Q8TAX7 MUC7 0.67442 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
immune system process GO:0002376
...
6 Q13467 FZD5 0.66871 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
7 Q9HCH3 CPNE5 0.65801 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...
8 Q96N03 VSTM2L 0.64197 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell death GO:0008219
...
9 A0A1B0GUW6 SPEM3 0.63439
10 Q8TE57 ADAMTS16 0.63407 anatomical structure development GO:0048856
cellular component assembly GO:0022607
circulatory system process GO:0003013
...

                                           20                  40                  60                  80                 100
AA:                      MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDY
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................
DO_IUPRED2A:             DDDDDDD...DD........................................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................
CONSENSUS_MOBI:          ....................................................................................................
RICH_[AG]:                                   GelAlrclAehGhslGGsAAA                                                           
RICH_[AH]:                                           AeHgHslggsAAAAAAA                                                       
RICH_[AL]:                                     LALrcLAehghsLggsAAAA                                                          
RICH_[A]:                                       AlrclAehghslggsAAAAAAAAAArckAAeA                                             
RICH_[C]:                                 CgggelalrC                                                                         
RICH_[G]:                          GrkapsGcGGGelalrclaehGhslGG                                                               
RICH_[CG]:                         GrkapsGCGGGelalrClaehGhslGG                                                               
RICH_[CL]:                                CgggeLaLrCLaehghsL                                                                 
RICH_[GL]:                               GcGGGeLaLrcLaehGhsLGG                                                               

                                          120                 140                 160                   
AA:                      ILDLQLALETHPALLRQPPPPAPPHHPAGTCPAAPPRTPLTALNTDPAGAVNKQGDSILCR
STMI:                                                                                 
DO_DISOPRED3:            .............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.D.
DO_IUPRED2A:             ...........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............
DO_SPOTD:                ..............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.D
CONSENSUS:               .............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...
CONSENSUS_MOBI:          ................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[PT]:                                         PagTcPaaPPrTPlTalnTdP              
RICH_[AH]:                                       HHpAgtcpAA                           
RICH_[AP]:                                PPPPAPPhhPAgtcPAAPPrtPltAlntdPAgA           
RICH_[AT]:                                          AgTcpAApprTplTAlnTdpA             
RICH_[P]:                                 PPPPaPPhhPagtcPaaPPrtP                      
RICH_[T]:                                             TcpaapprTplTalnT                
RICH_[HP]:                                PPPPaPPHHPagtcPaaPPrtP                      
RICH_fLPS_[P]:                            PPPPaPPhhPagtcPaaPPrtP                      
RICH_MOBI_[AH]:                                  HHpAgtcpAA                           
RICH_MOBI_[AP]:                           PPPPAPPhhPAgtcPAAPPrtPltA                   
RICH_MOBI_[AT]:                                     AgTcpAApprTplTAlnTdpA             
RICH_MOBI_[P]:                            PPPPaPPhhPagtcPaaPPrtP                      
RICH_MOBI_[T]:                                        TcpaapprTplTalnT                
RICH_MOBI_[HP]:                           PPPPaPPHHPagtcPaaPP                         
RICH_fLPS_MOBI_[P]:                       PPPPaPPhhPagtcPaaPPrtP