P49798 RGS4_HUMAN
Gene name: RGS4
Protein name: Regulator of G-protein signaling 4
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- cell-cell signaling GO:0007267
- cellular protein modification process GO:0006464
- circulatory system process GO:0003013
- cytoskeleton organization GO:0007010
- growth GO:0040007
- nervous system process GO:0050877
- signal transduction GO:0007165
- transmembrane transport GO:0055085
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P36544 | CHRNA7 | 0.74927 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell death GO:0008219 ... |
| 2 | Q92839 | HAS1 | 0.74927 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cell adhesion GO:0007155 ... |
| 3 | Q86TJ5 | ZNF554 | 0.65498 | |
| 4 | P51149 | RAB7A | 0.63213 | biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 cellular component assembly GO:0022607 ... |
| 5 | Q9UBB6 | NCDN | 0.54322 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell-cell signaling GO:0007267 ... |
| 6 | Q9H0T7 | RAB17 | 0.51447 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell junction organization GO:0034330 ... |
| 7 | Q96CP7 | TLCD1 | 0.46829 | cellular component assembly GO:0022607 homeostatic process GO:0042592 membrane organization GO:0061024 ... |
| 8 | Q9Y4D7 | PLXND1 | 0.46829 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 9 | Q5XKL5 | BTBD8 | 0.44228 | |
| 10 | P60368 | KRTAP10-2 | 0.43259 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
20 40 60 80 100 AA: MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKK STMI: DO_DISOPRED3: D......DDD...............DDDDDDDDDDDDDDDDDDDDDDDDD.................................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: .............................DDDDDDDDDDDDDDDD....................................................... CONSENSUS: .............................DDDDDDDDDDDDDDDD....................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[HK]: HnssHnKKdK RICH_[HS]: SdSceHnSSH
120 140 160 180 200 AA: IKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASL STMI: DO_DISOPRED3: ................................................................................DDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: .................................................................................................... DO_SPOTD: ................................................................................DDDDDDDDDDDDDDDDDDDD CONSENSUS: ................................................................................DDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: .................................................................................................... RICH_[AC]: CgAekqkgAkssAdCA
AA: VPQCA STMI: DO_DISOPRED3: DDDDD DO_IUPRED2A: ..... DO_SPOTD: DDDDD CONSENSUS: DDDDD CONSENSUS_MOBI: .....