P50238 CRIP1_HUMAN

Gene name: CRIP1
Protein name: Cysteine-rich protein 1

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell death GO:0008219
- immune system process GO:0002376
- reproduction GO:0000003
- response to stress GO:0006950
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

                                           20                  40                  60   
AA:                      MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK
STMI:                                                                                                 
DO_DISOPRED3:            ...............................................................DDDDDDDDDDDDDD
DO_IUPRED2A:             ............................................................................D
DO_SPOTD:                DD..............................................................DDDDDDDDDDDDD
CONSENSUS:               ................................................................DDDDDDDDDDDDD
CONSENSUS_MOBI:          .............................................................................