P51153 RAB13_HUMAN
Gene name: RAB13
Protein name: Ras-related protein Rab-13
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- cell junction organization GO:0034330
- cellular component assembly GO:0022607
- cellular protein modification process GO:0006464
- cytoskeleton organization GO:0007010
- membrane organization GO:0061024
- protein transport GO:0015031
- reproduction GO:0000003
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q5JVX7 | C1orf141 | 0.76606 | |
| 2 | Q7L2Z9 | CENPQ | 0.69673 | cell cycle GO:0007049 cellular component assembly GO:0022607 chromosome organization GO:0051276 ... |
| 3 | Q8NEA5 | C19orf18 | 0.67074 | |
| 4 | Q96PU4 | UHRF2 | 0.66801 | cell cycle GO:0007049 cell differentiation GO:0030154 cellular nitrogen compound metabolic process GO:0034641 ... |
| 5 | Q96AT1 | KIAA1143 | 0.65897 | |
| 6 | P11234 | RALB | 0.65452 | catabolic process GO:0009056 cell cycle GO:0007049 cell death GO:0008219 ... |
| 7 | P46063 | RECQL | 0.65441 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 ... |
| 8 | O60281 | ZNF292 | 0.65149 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 9 | B4E2M5 | ANKRD66 | 0.64611 | |
| 10 | Q5VU57 | AGBL4 | 0.62606 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
20 40 60 80 100 AA: MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQVWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQ STMI: DO_DISOPRED3: D................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DD.................................................................................................. CONSENSUS: D................................................................................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200 AA: NWMKSIKENASAGVERLLLGNKCDMEAKRKVQKEQADKLAREHGIRFFETSAKSSMNVDEAFSSLARDILLKSGGRRSGNGNKPPSTDLKTCDKKNTNKC STMI: DO_DISOPRED3: ...........................................................................DDDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: .................................D.D.....................................DDDDDDDDDDDDDDDDDDDDD...... DO_SPOTD: .........................................................................DDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: .........................................................................DDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ........................................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDD RICH_[K]: KppstdlKtcdKKntnK RICH_[N]: NgNkppstdlktcdkkNtN RICH_[CK]: KppstdlKtCdKKntnKC RICH_[KN]: NgNKppstdlKtcdKKNtNK RICH_MOBI_[K]: KppstdlKtcdKKntnK RICH_MOBI_[N]: NgNkppstdlktcdkkNtN RICH_MOBI_[CK]: KppstdlKtCdKKntnKC RICH_MOBI_[KN]: NgNKppstdlKtcdKKNtNK
AA: SLG STMI: DO_DISOPRED3: .DD DO_IUPRED2A: ..D DO_SPOTD: DDD CONSENSUS: DDD CONSENSUS_MOBI: DDD