P52434 RPAB3_HUMAN
Gene name: POLR2H
Protein name: DNA-directed RNA polymerases I, II, and III subunit RPABC3
List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- DNA metabolic process GO:0006259
- mRNA processing GO:0006397
- response to stress GO:0006950
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8N485 | LIX1 | 1 | catabolic process GO:0009056 |
| 2 | Q8N1C3 | GABRG1 | 0.98058 | cell-cell signaling GO:0007267 nervous system process GO:0050877 signal transduction GO:0007165 ... |
| 3 | Q8NE00 | TMEM104 | 0.91322 | |
| 4 | O75794 | CDC123 | 0.90809 | biosynthetic process GO:0009058 cell cycle GO:0007049 cell division GO:0051301 ... |
| 5 | P32121 | ARRB2 | 0.8633 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 6 | Q6NVV0 | MKRN9P | 0.84293 | |
| 7 | Q9UBS8 | RNF14 | 0.82353 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 8 | P52429 | DGKE | 0.82311 | biosynthetic process GO:0009058 cell-cell signaling GO:0007267 response to stress GO:0006950 ... |
| 9 | Q8NG06 | TRIM58 | 0.82311 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 10 | Q9C0I1 | MTMR12 | 0.82288 | biosynthetic process GO:0009058 transport GO:0006810 |
20 40 60 80 100 AA: MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIE STMI: DO_DISOPRED3: DD.................................................................DDDDDDDDDDDDDDDD................. DO_IUPRED2A: ......................................................................DDDDDDDDDDD................... DO_SPOTD: D................................................................................................... CONSENSUS: D.....................................................................DDDDDDDDDDD................... CONSENSUS_MOBI: .................................................................................................... RICH_[D]: DDgeynptDD RICH_fLPS_[D]: DDgeynptDD
120 140 AA: GDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF STMI: DO_DISOPRED3: .................................................. DO_IUPRED2A: .................................................. DO_SPOTD: .................................................. CONSENSUS: .................................................. CONSENSUS_MOBI: ..................................................