P52566 GDIR2_HUMAN
Gene name: ARHGDIB
Protein name: Rho GDP-dissociation inhibitor 2
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell adhesion GO:0007155
- cytoskeleton organization GO:0007010
- reproduction GO:0000003
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9UK97 | FBXO9 | 0.85679 | catabolic process GO:0009056 cell differentiation GO:0030154 cellular protein modification process GO:0006464 ... |
| 2 | O95373 | IPO7 | 0.85624 | biological process involved in symbiotic interaction GO:0044403 cell cycle GO:0007049 cellular protein modification process GO:0006464 ... |
| 3 | A1XBS5 | FAM92A | 0.83414 | anatomical structure development GO:0048856 cellular component assembly GO:0022607 membrane organization GO:0061024 ... |
| 4 | O15033 | AREL1 | 0.82821 | catabolic process GO:0009056 cell death GO:0008219 cellular protein modification process GO:0006464 ... |
| 5 | O14787 | TNPO2 | 0.80614 | nucleocytoplasmic transport GO:0006913 protein transport GO:0015031 transport GO:0006810 |
| 6 | Q9BXY0 | MAK16 | 0.80538 | cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 |
| 7 | Q9HCN4 | GPN1 | 0.78792 | |
| 8 | O15379 | HDAC3 | 0.7817 | biosynthetic process GO:0009058 cell cycle GO:0007049 cell death GO:0008219 ... |
| 9 | O60678 | PRMT3 | 0.77451 | cellular protein modification process GO:0006464 |
| 10 | P55209 | NAP1L1 | 0.77439 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
20 40 60 80 100 AA: MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIV STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................D...D.........................DD............ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDD.DD.......................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. RICH_[E]: EkapEphvEEddddE RICH_[DE]: EkapEphvEEDDDDElD RICH_fLPS_[D]: apephveeDDDDelD RICH_MOBI_[E]: EkapEphvEEddddE RICH_MOBI_[DE]: EkapEphvEEDDDDElD RICH_fLPS_MOBI_[D]: apephveeDDDDelD
120 140 160 180 200 AA: LKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWT STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .....................................................DD............................................. DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
AA: E STMI: DO_DISOPRED3: . DO_IUPRED2A: . DO_SPOTD: . CONSENSUS: . CONSENSUS_MOBI: D