P53801 PTTG_HUMAN

Gene name: PTTG1IP
Protein name: Pituitary tumor-transforming gene 1 protein-interacting protein

List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056
- cell death GO:0008219
- cellular protein modification process GO:0006464
- nucleocytoplasmic transport GO:0006913
- protein transport GO:0015031
- response to stress GO:0006950
- signal transduction GO:0007165
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8WYA6 CTNNBL1 0.78907 anatomical structure development GO:0048856
cell death GO:0008219
cellular nitrogen compound metabolic process GO:0034641
...
2 P52294 KPNA1 0.77716 biological process involved in symbiotic interaction GO:0044403
catabolic process GO:0009056
cell death GO:0008219
...
3 Q9Y5U5 TNFRSF18 0.77098 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell death GO:0008219
...
4 Q8TDI8 TMC1 0.76954 anatomical structure development GO:0048856
cell differentiation GO:0030154
nervous system process GO:0050877
...
5 P21127 CDK11B 0.75852 biosynthetic process GO:0009058
cell cycle GO:0007049
cell death GO:0008219
...
6 Q9UKV3 ACIN1 0.74142 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...
7 O43709 BUD23 0.73526 cellular nitrogen compound metabolic process GO:0034641
chromosome organization GO:0051276
ribosome biogenesis GO:0042254
8 Q96BP3 PPWD1 0.72997 cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
mRNA processing GO:0006397
9 Q99933 BAG1 0.7293 cell death GO:0008219
protein folding GO:0006457
response to stress GO:0006950
...
10 P19086 GNAZ 0.72685 protein folding GO:0006457
signal transduction GO:0007165

                                           20                  40                  60                  80                 100
AA:                      MAPGVARGPTPYWRLRLGGAALLLLLIPVAAAQEPPGAACSQNTNKTCEECLKNVSCLWCNTNKACLDYPVTSVLPPASLCKLSSARWGVCWVNFEALII
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS                                                                MMMM
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............................................................
DO_IUPRED2A:             D...................................................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................
CONSENSUS:                                               DDDDDD..........................................................    
CONSENSUS_MOBI:                                          ................................................................    

                                          120                 140                 160
AA:                      TMSVVGGTLLLGIAICCCCCCRRKRSRKPDRSEEKAMREREERRIRQEERRAEMKTRHDEIRKKYGLFKEENPYARFENN
STMI:                    MMMMMMMMMMMMMMMMM                                                               
DO_DISOPRED3:            ..............................................................................DD
DO_IUPRED2A:             ..............................DDDDDDDDDDDDDDDDDDDDDDDD.D........................
DO_SPOTD:                ........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                                .............DDDDDDDDDDDDDDDDDDDDDDDDDD......................DD
CONSENSUS_MOBI:                           .............DDDDDDDDDDDDDDDDDDDDDDDDDDD.......................
RICH_[E]:                                                EEkamrErEErrirqEErraE                           
RICH_[R]:                                              RseekamReReeRRiRqeeRR                             
RICH_[ER]:                                             RsEEkamREREERRiRqEERRaE                           
RICH_fLPS_[R]:                                         RseekamReReeRRiRqeeRR                             
RICH_fLPS_[RE]:                                        RsEEkamREREERRiRqEERRaE                           
RICH_fLPS_[E]:                                           EEkamrErEErrirqEErraE                           
RICH_MOBI_[E]:                                           EEkamrErEErrirqEErraE                           
RICH_MOBI_[R]:                                         RseekamReReeRRiRqeeRRaemktR                       
RICH_MOBI_[EM]:                                              MrErEErrirqEErraEM                          
RICH_MOBI_[ER]:                                        RsEEkamREREERRiRqEERRaEmktR                       
RICH_MOBI_[MR]:                                              MReReeRRiRqeeRRaeM                          
RICH_fLPS_MOBI_[R]:                                           ReReeRRiRqeeRRaemktR