P53803 RPAB4_HUMAN
Gene name: POLR2K
Protein name: DNA-directed RNA polymerases I, II, and III subunit RPABC4
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
20 40 AA: MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR STMI: DO_DISOPRED3: DDDDDDDD.................................................. DO_IUPRED2A: DDDDDDDD.................................................. DO_SPOTD: DDDDDDDDDDDD...........................................DDD CONSENSUS: DDDDDDDD.................................................. CONSENSUS_MOBI: DDDDDDDDDDDD..............................................