P56134 ATPK_HUMAN

Gene name: ATP5MF
Protein name: ATP synthase subunit f, mitochondrial

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- generation of precursor metabolites and energy GO:0006091
- membrane organization GO:0061024
- small molecule metabolic process GO:0044281
- transmembrane transport GO:0055085
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

                                           20                  40                  60                  80      
AA:                      MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH
STMI:                                                                                  MMMMMMMMMMMMMMMMMMMM            
DO_DISOPRED3:            DDDDDDDDDDD...............................................................................D..D
DO_IUPRED2A:             ..............................................................................................
DO_SPOTD:                DDDDDDDDDDDDDDD......................................................................DDDDDDDDD
CONSENSUS:               DDDDDDDDDDD...................................................                    ........DDDD
CONSENSUS_MOBI:          ..............................................................                    ............