P56181 NDUV3_HUMAN

Gene name: NDUFV3
Protein name: NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial

List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- generation of precursor metabolites and energy GO:0006091
- protein-containing complex assembly GO:0065003

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O00329 PIK3CD 0.80575 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell death GO:0008219
...
2 Q6FHJ7 SFRP4 0.78338 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell death GO:0008219
...
3 P16278 GLB1 0.76129 carbohydrate metabolic process GO:0005975
catabolic process GO:0009056
immune system process GO:0002376
...
4 Q96LM5 C4orf45 0.75945
5 Q06187 BTK 0.74649 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell death GO:0008219
...
6 Q86VH5 LRRTM3 0.7251 anatomical structure development GO:0048856
cell junction organization GO:0034330
cellular component assembly GO:0022607
...
7 P26640 VARS1 0.71894 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
small molecule metabolic process GO:0044281
...
8 Q8TAZ6 CMTM2 0.70868
9 Q96QH2 PRAM1 0.68945 immune system process GO:0002376
signal transduction GO:0007165
transport GO:0006810
...
10 Q9NVD7 PARVA 0.68873 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell adhesion GO:0007155
...

                                           20                  40                  60                  80                 100
AA:                      MAAPCLLRQGRAGALKTMLQEAQVFRGLASTVSLSAESGKSEKGQPQNSKKQSPPKKPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMPQPS
STMI:                    TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT                                                                  
DO_DISOPRED3:            DDDD...D..................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................
DO_IUPRED2A:             ..........DDDD..DDD..........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................DDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                                                 DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................DDDDDDDD
CONSENSUS_MOBI:                                            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................
RICH_[K]:                                                       KseKgqpqnsKKqsppKK                                           
RICH_[P]:                                                             PqnskkqsPPkkPaPvPaeP                                   
RICH_[KP]:                                                      KseKgqPqnsKKqsPPKKPaPvPaeP                                   
RICH_[KQ]:                                                         KgQpQnsKKQsppKK                                           
RICH_fLPS_[K]:                                                sgKseKgqpqnsKKqsppKK                                           
RICH_MOBI_[K]:                                                  KseKgqpqnsKKqsppKK                                           
RICH_MOBI_[P]:                                                        PqnskkqsPPkkPaPvPaeP                                   
RICH_MOBI_[KP]:                                                    KgqPqnsKKqsPPKKPaPvPaeP                                   
RICH_MOBI_[KQ]:                                                    KgQpQnsKKQsppKK                                           
RICH_fLPS_MOBI_[K]:                                           sgKseKgqpqnsKKqsppKK                                           

                                     
AA:                      SGRESPRH
STMI:                            
DO_DISOPRED3:            DDDDDDDD
DO_IUPRED2A:             DDDDDDDD
DO_SPOTD:                DDDDDDDD
CONSENSUS:               DDDDDDDD
CONSENSUS_MOBI:          ........