P56211 ARP19_HUMAN

Gene name: ARPP19
Protein name: cAMP-regulated phosphoprotein 19

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- carbohydrate metabolic process GO:0005975
- cell cycle GO:0007049
- cell division GO:0051301
- cellular protein modification process GO:0006464
- mitotic cell cycle GO:0000278
- small molecule metabolic process GO:0044281
- transmembrane transport GO:0055085
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O43148 RNMT 0.76141 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
2 P18858 LIG1 0.71498 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...
3 P11137 MAP2 0.69805 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...
4 O43768 ENSA 0.69786 cell cycle GO:0007049
cell division GO:0051301
cell-cell signaling GO:0007267
...
5 Q8TCT9 HM13 0.69295 anatomical structure development GO:0048856
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...
6 Q49MG5 MAP9 0.68602 cell cycle GO:0007049
cell division GO:0051301
cellular component assembly GO:0022607
...
7 Q96BK5 PINX1 0.68114 biosynthetic process GO:0009058
cell cycle GO:0007049
cell population proliferation GO:0008283
...
8 Q9NP80 PNPLA8 0.66841 biosynthetic process GO:0009058
catabolic process GO:0009056
cell death GO:0008219
...
9 Q13061 TRDN 0.66586 circulatory system process GO:0003013
cytoskeleton organization GO:0007010
homeostatic process GO:0042592
...
10 A6NCM1 IQCA1L 0.66579

                                           20                  40                  60                  80                 100
AA:                      MSAEVPEAASAEEQKEMEDKVTSPEKAEEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMAKAKMKNKQLPTAAPDKTEVTGDHIPTPQDLPQ
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDD...D...........................................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................DDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[PT]:                                                                                            PTaaPdkTevTgdhiPTP     
RICH_[AE]:                 AEvpEAAsAEEqkEmE      EkAEEAklkA                                                                  
RICH_[AK]:                                                                                  AKAKmKnKqlptAApdK                
RICH_[E]:                   EvpEaasaEEqkEmE                                                                                  
RICH_[K]:                              KemedKvtspeKaeeaKlK        KpggsdflrKrlqKgqK          KaKmKnKqlptaapdK                
RICH_[T]:                                                                                              TaapdkTevTgdhipT      
RICH_[EK]:                          EEqKEmEdKvtspEKaEEaKlK                                                                   
RICH_[GK]:                                                      GqKpGGsdflrKrlqKGqK                                          
RICH_[KN]:                                                                                NmaKaKmKNK                         
RICH_[KY]:                                                                 KrlqKgqKYfdsgdYnmaKaKmKnK                         
RICH_fLPS_[E]:              EvpEaasaEEqkEmEdkvtspEkaEE                                                                       
RICH_MOBI_[AE]:            AEvpEAAsAEEqkEmE                                                                                  
RICH_MOBI_[AM]:          MsAevpeAAsAeeqkeM                                                                                   
RICH_MOBI_[E]:              EvpEaasaEEqkEmE                                                                                  
RICH_MOBI_[K]:                         KemedKvtspeKaeeaKlK                                                                   
RICH_MOBI_[T]:                                                                                         TaapdkTevTgdhipT      
RICH_MOBI_[EK]:                     EEqKEmEdKvtspEKaEEaKlK                                                                   
RICH_MOBI_[EM]:          MsaEvpEaasaEEqkEME                                                                                  

                                 
AA:                      RKPSLVASKLAG
STMI:                                
DO_DISOPRED3:            ....D...DDDD
DO_IUPRED2A:             DDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDD