P56378 ATP68_HUMAN
Gene name: ATP5MPL
Protein name: ATP synthase subunit ATP5MPL, mitochondrial
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
20 40 AA: MLQSIIKNIWIPMKPYYTKVYQEIWIGMGLMGFIVYKIRAADKRSKALKASAPAPGHH STMI: MMMMMMMMMMMMMMMMMMM DO_DISOPRED3: D...............................................DDDDDDDDDD DO_IUPRED2A: .......................................................... DO_SPOTD: DDDD....................................DDDDDDDDDDDDDDDDDD CONSENSUS: D.................. ..........DDDDDDDDDD CONSENSUS_MOBI: ................... ....................