P58512 CU067_HUMAN

Gene name: LINC01547
Protein name: Uncharacterized protein encoded by LINC01547

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 A6NCW0 USP17L3 0.65479 catabolic process GO:0009056
cell death GO:0008219
cellular protein modification process GO:0006464
2 Q9Y252 RNF6 0.64477 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
3 Q6R6M4 USP17L2 0.63947 catabolic process GO:0009056
cell cycle GO:0007049
cell death GO:0008219
...
4 A6NCW7 USP17L4 0.62567 cell death GO:0008219
cellular protein modification process GO:0006464
5 P0C7I0 USP17L8 0.62453 catabolic process GO:0009056
cell death GO:0008219
cellular protein modification process GO:0006464
6 Q9H2D6 TRIOBP 0.58103 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell cycle GO:0007049
...
7 O00505 KPNA3 0.57785 biological process involved in symbiotic interaction GO:0044403
cellular component assembly GO:0022607
nucleocytoplasmic transport GO:0006913
...
8 Q9NR99 MXRA5 0.57377
9 A6NGC4 TLCD2 0.5699 cellular component assembly GO:0022607
homeostatic process GO:0042592
membrane organization GO:0061024
...
10 Q96LI9 CXorf58 0.56364

                                           20                  40                  60                  80                 100
AA:                      MGWDCRRTTVENPSPIRNCVNQEWPEGSSPGLTEGNTGLVRDLRPAHQDRSGTREDPAGQETTAITNPSPSLAADLAGDALPGCLGAAAHQGPLLDRSSE
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDD.D............................................................................................
DO_IUPRED2A:             .DDDDDDD...DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..D...............D..DDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............DDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................
RICH_[N]:                           NpspirNcvN                                                                               
RICH_[R]:                                                        RdlRpahqdRsgtR                                              
RICH_[T]:                                                                    TredpagqeTTaiT                                  
RICH_MOBI_[C]:               CrrttvenpspirnC                                                                                 
RICH_MOBI_[N]:                      NpspirNcvN                                                                               
RICH_MOBI_[R]:                                                   RdlRpahqdRsgtR                                              
RICH_MOBI_[T]:                                                               TredpagqeTTaiT                                  

                                          120                 140                 160                 180                 200
AA:                      STLGPQALELEHCHERGCCRGCASFSPFPAPRCPSERLGAHSSRWAIRGRSKINPPPWAPACLPGGFPACLPAPKSSTDSASSCFKGGREFSDPLDIPGA
STMI:                                                                                                                        
DO_DISOPRED3:            ..........................................................................DDDDDDDDD...............D.
DO_IUPRED2A:             DDD.DDD.........................DD.D..D.D..DDDDDDDD...........................................DDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDDDDDDDDDDDDDDDDDDDDD...DDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDD.........................DDDDDDDDDDDDDDDDDDD.......................DDDDDDDDD...........DDDDDD
CONSENSUS_MOBI:          ....................................................................................................

                                         
AA:                      GAMG
STMI:                        
DO_DISOPRED3:            DDDD
DO_IUPRED2A:             DDDD
DO_SPOTD:                DDDD
CONSENSUS:               DDDD
CONSENSUS_MOBI:          ....