P58753 TIRAP_HUMAN

Gene name: TIRAP
Protein name: Toll/interleukin-1 receptor domain-containing adapter protein

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- immune system process GO:0002376
- nucleobase-containing compound catabolic process GO:0034655
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 A6NKQ9 CGB1 0.84287 signal transduction GO:0007165
2 Q5JRV8 TMEM255A 0.82737
3 P0DN86 CGB3 0.81467 biosynthetic process GO:0009058
cell death GO:0008219
cell-cell signaling GO:0007267
...
4 O94887 FARP2 0.81047 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
5 Q96MM6 HSPA12B 0.80027
6 Q02156 PRKCE 0.78671 carbohydrate metabolic process GO:0005975
catabolic process GO:0009056
cell adhesion GO:0007155
...
7 Q75MW2 ZNF767P 0.78037
8 Q92519 TRIB2 0.78022 catabolic process GO:0009056
cell differentiation GO:0030154
cellular protein modification process GO:0006464
...
9 Q6NT52 CGB2 0.75933 signal transduction GO:0007165
10 P57682 KLF3 0.75771 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641

                                           20                  40                  60                  80                 100
AA:                      MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPSLSSVTSPSLPPTHASDSGSSRWSKDYDVCVCHSEEDLVAA
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDD....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDD..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDD........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDD........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................
CONSENSUS_MOBI:          DDDDDDDDDDDDDD.....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........................
RICH_[PS]:                                               PkkrPnSPeStSSdaSqPtS  SPlPPSlSSvtSPSlPPthaSdS                       
RICH_[P]:                                                                       PlPPslssvtsPslPP                             
RICH_[S]:                                                      SpeStSSdaSqptSqdSplppSlSSvtSpSlppthaSdSgS                     
RICH_MOBI_[PS]:                                                             SqdSPlPPSlSSvtSPSlPPthaS                         
RICH_MOBI_[P]:                                                                  PlPPslssvtsPslPP                             
RICH_MOBI_[S]:                                                 SpeStSSdaSqptSqdSplppSlSSvtSpS                                
RICH_MOBI_[LP]:                                                                 PLPPsLssvtsPsLPP                             
RICH_MOBI_[LS]:                                                                SpLppSLSSvtSpSL                               

                                          120                 140                 160                 180                 200
AA:                      QDLVSYLEGSTASLRCFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLSGLSRAAYPPELRFMYYVDGR
STMI:                                                                                                                        
DO_DISOPRED3:            ....................................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                ....................................................................................................
CONSENSUS:               ....................................................................................................
CONSENSUS_MOBI:          ....................................................................................................

                                          220                   
AA:                      GPDGGFRQVKEAVMRYLQTLS
STMI:                                         
DO_DISOPRED3:            .....................
DO_IUPRED2A:             .....................
DO_SPOTD:                .....................
CONSENSUS:               .....................
CONSENSUS_MOBI:          .....................