P59020 DSCR9_HUMAN

Gene name: DSCR9
Protein name: Down syndrome critical region protein 9

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9NS28 RGS18 0.9246 signal transduction GO:0007165
2 Q9NVD3 SETD4 0.87707 cellular protein modification process GO:0006464
3 P27539 GDF1 0.84435 cellular protein modification process GO:0006464
signal transduction GO:0007165
4 A8K010 LINC00473 0.8431 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
5 Q9UNQ2 DIMT1 0.83913 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
6 O43812 DUX1 0.83517 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
7 Q8WYQ4 C22orf15 0.82131
8 Q86V25 VASH2 0.81704 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
9 P48556 PSMD8 0.81167 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
10 Q96D70 R3HDM4 0.80864

                                           20                  40                  60                  80                 100
AA:                      MGRICPVNSRARRLRARPGRPSGDSLPYHQLQGGAPRLWSPDPGRPAAYRRAHVCDVTAPRWGSTSRQGEGAVLQRMLGRRAPPSWSRDHAYSRRGWENA
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDD..DDDDDDD..DDDDDDD................................D..D.........................................
DO_IUPRED2A:             .......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....DD........DDD...DDDDDDDDDDDDDDDD...DD..DDD.........
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....DD....DDDDDDDDDDDDDD...............................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................................................
RICH_[R]:                  RicpvnsRaRRlRaRpgR                                                                                
RICH_[GP]:                                PGrPsGdslPyhqlqGGaP                                                                
RICH_fLPS_[R]:           mgRicpvnsRaRRlRaRpgR                                                                                
RICH_MOBI_[R]:             RicpvnsRaRRlRaRpgR                                                                                
RICH_fLPS_MOBI_[R]:      mgRicpvnsRaRRlRaRpgR                                                                                

                                          120                 140           
AA:                      ALFLNRKRKQEGTENTSICCRPESALACGGNLSPQFLKKVIQIQTQELW
STMI:                                                                     
DO_DISOPRED3:            .................................................
DO_IUPRED2A:             ...DDDDD.....DDDD................................
DO_SPOTD:                ..D.DDDDDDDDDDD...............................DDD
CONSENSUS:               ....DDDD.....DD..................................
CONSENSUS_MOBI:          .................................................