P59074 CHM4P_HUMAN

Gene name: CHMP4BP1
Protein name: Putative charged multivesicular body protein 4B-like protein CHMP4BP1

List of terms from Generic GO subset, which this protein is a part of:
- membrane organization GO:0061024
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8WUA4 GTF3C2 0.59923 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
2 Q9BW85 YJU2 0.5983 cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
response to stress GO:0006950
...
3 P52746 ZNF142 0.57698 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
4 Q12849 GRSF1 0.56991 anatomical structure development GO:0048856
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...
5 Q9ULD5 ZNF777 0.55735 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
6 Q9BYH1 SEZ6L 0.55733 anatomical structure development GO:0048856
cell junction organization GO:0034330
developmental maturation GO:0021700
...
7 Q7RTP6 MICAL3 0.55635 cell cycle GO:0007049
cell division GO:0051301
cytoskeleton organization GO:0007010
...
8 A4FU49 SH3D21 0.5525
9 Q96SF2 CCT8L2 0.54991
10 A6NM43 CCT8L1P 0.54908

                                           20                  40                  60                  80                 100
AA:                      MLSKKQEFLEKKIEQRHGTKNKPAALQALKRKKRYEKQLAQIDGTLSTIEFQQQALENANTNTEVLKNMGSAAKAKKAAHDNMDIDKVDELMQDIADQQE
STMI:                                                                                                                        
DO_DISOPRED3:            D...................................................................................................
DO_IUPRED2A:             ......DDDDDDDDDDDDDDDDDDDDDDD.D..................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDD..DDDDDDDDD................................................................................
CONSENSUS:               D.....DDDDDDDDDDDDDD................................................................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDD............................................................................
RICH_MOBI_[K]:              KKqefleKKieqrhgtKnK                                                                              
RICH_fLPS_MOBI_[K]:        sKKqefleKKieqrhgtKnK                                                                              

                                          120                 140                 160         
AA:                      LGEEISTAISKPVGFGEKSDEDELMAELEELEQEEPDKNLLEVSGPETVPLPNVPSIALPSKPAKKRKTTT
STMI:                                                                                           
DO_DISOPRED3:            ...........................................D.D...DDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                ..........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ..........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ...............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[E]:                                EksdEdElmaElEElEqEEpdknllEvsgpE                        
RICH_[P]:                                                             PetvPlPnvPsialPskP        
RICH_[EL]:                                   EdELmaELEELEqEEpdknLLEvsgpE                        
RICH_[EP]:                                                EEPdknllEvsgPEtvPlP                   
RICH_[KP]:                                                                PlPnvPsialPsKPaKKrK   
RICH_[KT]:                                                                            KpaKKrKTTT
RICH_[LP]:                                                      LLevsgPetvPLPnvPsiaL            
RICH_fLPS_[E]:                          gEksdEdElmaElEElEqEE                                    
RICH_MOBI_[PV]:                                                       PetVPlPnVP                
RICH_MOBI_[L]:                                                  LLevsgpetvpLpnvpsiaL            
RICH_MOBI_[P]:                                                        PetvPlPnvPsialPskP        
RICH_MOBI_[KT]:                                                                       KpaKKrKTTT
RICH_MOBI_[LV]:                                                 LLeVsgpetVpLpnV