P60321 NANO2_HUMAN

Gene name: NANOS2
Protein name: Nanos homolog 2

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cell cycle GO:0007049
- cell differentiation GO:0030154
- cellular nitrogen compound metabolic process GO:0034641
- nucleobase-containing compound catabolic process GO:0034655
- reproduction GO:0000003
- translation GO:0006412

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9BXM7 PINK1 0.8344 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
2 P62136 PPP1CA 0.83199 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
3 P48546 GIPR 0.83076 anatomical structure development GO:0048856
cell-cell signaling GO:0007267
generation of precursor metabolites and energy GO:0006091
...
4 Q96DH6 MSI2 0.77786 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular nitrogen compound metabolic process GO:0034641
5 Q8TE58 ADAMTS15 0.73983
6 Q8NE28 STKLD1 0.73159
7 Q9Y614 ACTL7B 0.70878
8 Q96BZ9 TBC1D20 0.70024 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biological process involved in symbiotic interaction GO:0044403
...
9 Q8N1Y9 n/a 0.69813
10 O15552 FFAR2 0.69438 cell differentiation GO:0030154
cell-cell signaling GO:0007267
homeostatic process GO:0042592
...

                                           20                  40                  60                  80                 100
AA:                      MQLPPFDMWKDYFNLSQVVWALIASRGQRLETQEIEEPSPGPPLGQDQGLGAPGANGGLGTLCNFCKHNGESRHVYSSHQLKTPDGVVVCPILRHYVCPV
STMI:                                                                                                                        
DO_DISOPRED3:            D.........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................................
DO_IUPRED2A:             ..............................DDDDDDDDDDDDDDDDDDDDDD.......................DDD......................
DO_SPOTD:                DDD.......................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........................................
CONSENSUS:               D.........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................................
CONSENSUS_MOBI:          ..............................DDDDDDDDDDDDDDDDDDDDDDDDD.............................................
RICH_[G]:                                                        GpplGqdqGlGapGanG                                           
RICH_[EP]:                                             EtqEiEEPsPgPP                                                         
RICH_[GP]:                                                    PsPGPPlGqdqGlGaPGanG                                           
RICH_MOBI_[G]:                                                   GpplGqdqGlGapG                                              

                                          120  
AA:                      CGATGDQAHTLKYCPLNGGQQSLYRRSGRNSAGRRVKR
STMI:                                                          
DO_DISOPRED3:            .........................DDDDDDDDDDDDD
DO_IUPRED2A:             .......................DDDDDDDDDDDDDDD
DO_SPOTD:                .....DDDDD......DDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               .......................DDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ......................................
RICH_[R]:                                        RRsgRnsagRRvkR
RICH_fLPS_[R]:                                  yRRsgRnsagRRvkR