P60468 SC61B_HUMAN

Gene name: SEC61B
Protein name: Protein transport protein Sec61 subunit beta

List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056
- protein targeting GO:0006605
- protein transport GO:0015031
- response to stress GO:0006950
- transmembrane transport GO:0055085
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9HA82 CERS4 0.7225 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
2 Q12834 CDC20 0.69021 anatomical structure development GO:0048856
catabolic process GO:0009056
cell cycle GO:0007049
...
3 Q8NCQ2 CSNK1G2-AS1 0.67326
4 Q6PK18 OGFOD3 0.66013
5 Q52M58 C14orf177 0.65124
6 Q8IZ02 LRRC34 0.65014 cell differentiation GO:0030154
7 Q9H1C0 LPAR5 0.647 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
response to stress GO:0006950
...
8 Q9NUU6 OTULINL 0.64444
9 A6NGC4 TLCD2 0.64361 cellular component assembly GO:0022607
homeostatic process GO:0042592
membrane organization GO:0061024
...
10 Q6ZSR3 n/a 0.63615

                                           20                  40                  60                  80    
AA:                      MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS
STMI:                                                                                          MMMMMMMMMMMMMMMMMMMMM     
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....DD.........................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........................................DDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................                     .....
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................                     .....
RICH_[AR]:                              RspskAvAARAAgstvRqR                                                              
RICH_[A]:                                    AvAArAAgstvrqrknA                                                           
RICH_[RT]:                                            TvRqRknascgTRsagRTT                                                
RICH_[R]:                               RspskavaaRaagstvRqR                                                              
RICH_[T]:                                             TvrqrknascgTrsagrTT                                                
RICH_[GP]:                PGPtPsGtnvGssGrsP                                                                              
RICH_fLPS_[A]:                            pskAvAArAA                                                                     
RICH_MOBI_[AR]:                         RspskAvAARAAgstvRqR                                                              
RICH_MOBI_[AV]:                               VAArAAgstV                                                                 
RICH_MOBI_[A]:                               AvAArAAgstvrqrknA                                                           
RICH_MOBI_[RT]:                                       TvRqRknascgTRsagRTT                                                
RICH_MOBI_[G]:                                                  GtrsaGrttsaGtGG                                          
RICH_MOBI_[R]:                          RspskavaaRaagstvRqR                                                              
RICH_MOBI_[T]:                                        TvrqrknascgTrsagrTT                                                
RICH_MOBI_[GT]:                                                 GTrsaGrTTsaGTGG                                          
RICH_fLPS_MOBI_[A]:                       pskAvAArAA