P60602 ROMO1_HUMAN
Gene name: ROMO1
Protein name: Reactive oxygen species modulator 1
List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- cell population proliferation GO:0008283
- immune system process GO:0002376
- membrane organization GO:0061024
- protein targeting GO:0006605
- protein transport GO:0015031
- response to stress GO:0006950
- transmembrane transport GO:0055085
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
20 40 60 AA: MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTFMAIGMGIRC STMI: MMMMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDD................................................................... DO_IUPRED2A: ............................................................................... DO_SPOTD: DDDDDDDDDDD................................................................DDDD CONSENSUS: DDDDDDDDDDD.......... ................................... CONSENSUS_MOBI: ..................... ...................................