P61165 TM258_HUMAN

Gene name: TMEM258
Protein name: Transmembrane protein 258

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

                                           20                  40                  60 
AA:                      MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVASLFMGFGVLFLLLWVGIYV
STMI:                                    MMMMMMMMMMMMMMMMMMMMM                 MMMMMMMMMMMMMMMMMMMMM    
DO_DISOPRED3:            DD.............................................................................
DO_IUPRED2A:             ...............................................................................
DO_SPOTD:                DDDDDDD........................................................................
CONSENSUS:               DD..............                     .................                     ....
CONSENSUS_MOBI:          ................                     .................                     ....