P61218 RPAB2_HUMAN

Gene name: POLR2F
Protein name: DNA-directed RNA polymerases I, II, and III subunit RPABC2

List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- DNA metabolic process GO:0006259
- mRNA processing GO:0006397
- response to stress GO:0006950
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P15498 VAV1 0.81776 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell death GO:0008219
...
2 Q7Z6M4 MTERF4 0.75442 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular component assembly GO:0022607
...
3 P58658 EVA1C 0.71504
4 Q9BUF5 TUBB6 0.6855 cell cycle GO:0007049
cytoskeleton organization GO:0007010
mitotic cell cycle GO:0000278
5 Q8IV16 GPIHBP1 0.68108 homeostatic process GO:0042592
protein transport GO:0015031
transport GO:0006810
...
6 A2RRP1 NBAS 0.67694 catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
nucleobase-containing compound catabolic process GO:0034655
...
7 Q9NWB7 IFT57 0.65998 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell death GO:0008219
...
8 O75419 CDC45 0.65578 biosynthetic process GO:0009058
cell cycle GO:0007049
cellular component assembly GO:0022607
...
9 Q5VW36 FOCAD 0.65222
10 Q8N8V4 ANKS4B 0.64015 cell differentiation GO:0030154
cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
...

                                           20                  40                  60                  80                 100
AA:                      MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKAR
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............................................
CONSENSUS_MOBI:          ....................................................................................................
RICH_[D]:                  DneDnfDgDDfDDveeDeglDD                                                                            
RICH_[E]:                                EEdEglddlEnaEEEgqEnvEilpsgE                                                         
RICH_[DE]:                 DnEDnfDgDDfDDvEEDEglDDlEnaEEE                                                                     
RICH_[DF]:                 DneDnFDgDDFDDveeD                                                                                 
RICH_[DN]:                 DNeDNfDgDD                                                                                        
RICH_[EN]:                                        ENaEEEgqEN                                                                 
RICH_[FN]:                  NedNFdgddF                                                                                       
RICH_fLPS_[DE]:            DnEDnfDgDDfDDvEEDEglDDlEnaEEEgqEnvE                                                               
RICH_fLPS_[D]:             DneDnfDgDDfDDveeDeglDD                                                                            
RICH_fLPS_[E]:                           EEdEglddlEnaEEEgqEnvE                                                               

                                          120             
AA:                      KIPIIIRRYLPDGSYEDWGVDELIITD
STMI:                                               
DO_DISOPRED3:            ...........................
DO_IUPRED2A:             ...........................
DO_SPOTD:                ...........................
CONSENSUS:               ...........................
CONSENSUS_MOBI:          ...........................