P62256 UBE2H_HUMAN
Gene name: UBE2H
Protein name: Ubiquitin-conjugating enzyme E2 H
List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056
- cellular protein modification process GO:0006464
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9UKD2 | MRTO4 | 0.70814 | catabolic process GO:0009056 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 2 | Q13316 | DMP1 | 0.69981 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ... |
| 3 | Q96PQ7 | KLHL5 | 0.69858 | cellular protein modification process GO:0006464 |
| 4 | Q5PSV4 | BRMS1L | 0.69286 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 5 | Q8N5I9 | C12orf45 | 0.67657 | |
| 6 | Q5MJ10 | SPANXN2 | 0.67086 | |
| 7 | A1L162 | ERICH2 | 0.66937 | |
| 8 | P57078 | RIPK4 | 0.66546 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 9 | O94818 | NOL4 | 0.6534 | |
| 10 | Q6PI26 | SHQ1 | 0.64518 | cell death GO:0008219 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
20 40 60 80 100 AA: MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYD STMI: DO_DISOPRED3: DDDDDD.............................................................................................. DO_IUPRED2A: DDDDDDD............................................................................................. DO_SPOTD: DDDDDDDD............................................................................................ CONSENSUS: DDDDDDD............................................................................................. CONSENSUS_MOBI: DDD.................................................................................................
120 140 160 180 AA: LTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL STMI: DO_DISOPRED3: .......................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: .........................D.........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_SPOTD: ....................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ....................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ........................................................DDDDDDDDDDDDDDDDDDDDDDDDDDD RICH_[D]: DsssessmsDfseDeaqD RICH_[S]: SSSeSSmSdfS RICH_[DE]: DsssEssmsDfsEDEaqDmE RICH_[DM]: MsDfseDeaqDM RICH_[DS]: DSSSeSSmSDfSeDeaqD RICH_[ES]: EqEEgtgdSSSESSmSdfSEdE RICH_fLPS_[S]: gtgdSSSeSSmSdfS RICH_MOBI_[D]: DsssessmsDfseDeaqD RICH_MOBI_[S]: SSSeSSmSdfS RICH_MOBI_[DE]: DsssEssmsDfsEDEaqDmE RICH_MOBI_[DM]: DsssessMsDfseDeaqDM RICH_MOBI_[DS]: DSSSeSSmSDfSeDeaqD RICH_MOBI_[EM]: EssMsdfsEdEaqdME RICH_MOBI_[ES]: EEgtgdSSSESSmSdfSEdE RICH_MOBI_[MS]: SSSeSSMSdfSedeaqdM RICH_fLPS_MOBI_[S]: gdSSSeSSmS