P62258 1433E_HUMAN
Gene name: YWHAE
Protein name: 14-3-3 protein epsilon
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biological process involved in symbiotic interaction GO:0044403
- cell cycle GO:0007049
- cell death GO:0008219
- cell differentiation GO:0030154
- cellular component assembly GO:0022607
- cellular protein modification process GO:0006464
- circulatory system process GO:0003013
- homeostatic process GO:0042592
- membrane organization GO:0061024
- mitotic cell cycle GO:0000278
- nucleocytoplasmic transport GO:0006913
- protein targeting GO:0006605
- protein transport GO:0015031
- response to stress GO:0006950
- signal transduction GO:0007165
- transmembrane transport GO:0055085
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q92637 | FCGR1B | 0.82938 | immune system process GO:0002376 response to stress GO:0006950 signal transduction GO:0007165 ... |
| 2 | P12314 | FCGR1A | 0.81862 | cellular protein modification process GO:0006464 immune system process GO:0002376 membrane organization GO:0061024 ... |
| 3 | P06756 | ITGAV | 0.79927 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biological process involved in symbiotic interaction GO:0044403 ... |
| 4 | Q8NA66 | CNBD1 | 0.78765 | |
| 5 | Q9H9Q2 | COPS7B | 0.7661 | biological process involved in symbiotic interaction GO:0044403 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 6 | Q9BZK3 | NACA4P | 0.74254 | protein targeting GO:0006605 protein transport GO:0015031 transport GO:0006810 |
| 7 | Q9BQ95 | ECSIT | 0.7225 | cellular component assembly GO:0022607 immune system process GO:0002376 protein-containing complex assembly GO:0065003 ... |
| 8 | O95125 | ZNF202 | 0.7057 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 9 | Q8NFK1 | GJC3 | 0.70378 | anatomical structure development GO:0048856 cell-cell signaling GO:0007267 nervous system process GO:0050877 |
| 10 | O00461 | GOLIM4 | 0.70295 |
20 40 60 80 100 AA: MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDI STMI: DO_DISOPRED3: D................................................................................................... DO_IUPRED2A: .........................................................................D..D....................... DO_SPOTD: DD.................................................................................................. CONSENSUS: D................................................................................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200 AA: LDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFD STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 240 AA: DAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ STMI: DO_DISOPRED3: ....................................DDDDDDDDDDDDDDDDDDD DO_IUPRED2A: .................................DDDDDDDDDDDDDDDDDDDDDD DO_SPOTD: ..................................DDDDDDDDDDDDDDDDDDDDD CONSENSUS: ..................................DDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: .................................DDDDDDDDDDDDDDDDDDDDDD RICH_[E]: EEqnkEalqdvEdE RICH_[Q]: QgdgeeQnkealQdvedenQ RICH_[EQ]: QgdgEEQnkEalQdvEdEnQ RICH_MOBI_[D]: DmqgDgeeqnkealqDveD RICH_MOBI_[E]: EEqnkEalqdvEdE RICH_MOBI_[Q]: QgdgeeQnkealQdvedenQ RICH_MOBI_[DE]: DmqgDgEEqnkEalqDvEDE RICH_MOBI_[EQ]: QgdgEEQnkEalQdvEdEnQ